KEGG   Proteus mirabilis HI4320: PMI0570Help
Entry
PMI0570           CDS       T00753                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pmr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pmr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616607..617815
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKVVLEVPASEAGVLDSI
LEEEGATVGSRQLLGRIRLGDSTGIPADVKPAQDTTPAQRQSADIVAKESNDALSPTARR
LVAEHDINPADVKGSGVGGRLTRQDIESHVANNKSAAAATAEVSQAPLSHRSEKRVPMTR
LRKRVAERLLEAKNTTAMLTTFNEINMQPIKNLRAQYGEAFEKRHGVRLGFMSFYIKAVV
EALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDADAMSMADIEKNIKALA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGQVV
ILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtagatattctagtaccggatctccctgaatcagttgctgacgcgacagtc
gcaacttggcataaaaaacctggtgatagcattcaacgcgatgaagtgctggttgaaatt
gaaacagataaagttgtgttagaagtaccggcgagtgaagctggggtgctggatagcatt
cttgaagaagaaggcgctacggtaggttcacgtcaattattaggacgtattcgtcttggt
gatagcactggtattcctgcggatgtgaaacctgcacaagatacgacgcctgcgcaacgt
caaagtgcagatattgttgcgaaagaaagcaatgatgctcttagcccgacagcacgtcgt
ttagtcgctgaacacgatattaatccagcagatgtaaaaggcagtggtgttggtggacgc
ttaactcgtcaagatattgaaagccatgttgctaataataaatcagcagcagcggccacc
gctgaagtttctcaagctccattatcgcatcgtagtgagaaacgtgtaccaatgacacgt
ttacgcaaacgtgttgcagagcgtttattagaagcgaaaaatactaccgccatgttgaca
acgtttaacgaaatcaacatgcagcctattaaaaatttacgtgcgcaatatggtgaagca
ttcgaaaaacgccacggtgtacgtttaggctttatgtctttctacattaaagcggtagtg
gaagcgttaaaacgttatccagaagtcaatgcgtctattgatggtactgatgtggtttac
cacaactattttgatatcagtattgccgtatcaacacctcgtggtctggtaacaccggta
ttacgtgatgcagatgcgatgagcatggcggatattgagaaaaatatcaaagcattagca
gtgaaaggtcgtgatggtaaattaaccgttgaagatttaacaggcggtaattttactatt
actaacggtggtgtttttggctcattaatgtcaacaccgattatcaacccaccacaaagt
gctattttgggtatgcatgcgattaaagatcgcccaatggcagttgatggtcaggttgtt
attctacctatgatgtatctagcactttcttatgaccatcgtttaattgatggccgtgag
tctgtcggtttcttagtgaccgttaaagaaatgctagaagatcctgcccgtttattactg
gatgtgtag

DBGET integrated database retrieval system