KEGG   Proteus mirabilis HI4320: PMI0570Help
Entry
PMI0570           CDS       T00753                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00020  Citrate cycle (TCA cycle)
pmr00310  Lysine degradation
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01130  Biosynthesis of antibiotics
pmr01200  Carbon metabolism
Module
pmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMI0570 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PMI0570 (sucB)
Enzymes [BR:pmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PMI0570 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MDMPI_N Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: CAR41368
UniProt: B4ESR0
Position
616607..617815
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKVVLEVPASEAGVLDSI
LEEEGATVGSRQLLGRIRLGDSTGIPADVKPAQDTTPAQRQSADIVAKESNDALSPTARR
LVAEHDINPADVKGSGVGGRLTRQDIESHVANNKSAAAATAEVSQAPLSHRSEKRVPMTR
LRKRVAERLLEAKNTTAMLTTFNEINMQPIKNLRAQYGEAFEKRHGVRLGFMSFYIKAVV
EALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDADAMSMADIEKNIKALA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGQVV
ILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtagatattctagtaccggatctccctgaatcagttgctgacgcgacagtc
gcaacttggcataaaaaacctggtgatagcattcaacgcgatgaagtgctggttgaaatt
gaaacagataaagttgtgttagaagtaccggcgagtgaagctggggtgctggatagcatt
cttgaagaagaaggcgctacggtaggttcacgtcaattattaggacgtattcgtcttggt
gatagcactggtattcctgcggatgtgaaacctgcacaagatacgacgcctgcgcaacgt
caaagtgcagatattgttgcgaaagaaagcaatgatgctcttagcccgacagcacgtcgt
ttagtcgctgaacacgatattaatccagcagatgtaaaaggcagtggtgttggtggacgc
ttaactcgtcaagatattgaaagccatgttgctaataataaatcagcagcagcggccacc
gctgaagtttctcaagctccattatcgcatcgtagtgagaaacgtgtaccaatgacacgt
ttacgcaaacgtgttgcagagcgtttattagaagcgaaaaatactaccgccatgttgaca
acgtttaacgaaatcaacatgcagcctattaaaaatttacgtgcgcaatatggtgaagca
ttcgaaaaacgccacggtgtacgtttaggctttatgtctttctacattaaagcggtagtg
gaagcgttaaaacgttatccagaagtcaatgcgtctattgatggtactgatgtggtttac
cacaactattttgatatcagtattgccgtatcaacacctcgtggtctggtaacaccggta
ttacgtgatgcagatgcgatgagcatggcggatattgagaaaaatatcaaagcattagca
gtgaaaggtcgtgatggtaaattaaccgttgaagatttaacaggcggtaattttactatt
actaacggtggtgtttttggctcattaatgtcaacaccgattatcaacccaccacaaagt
gctattttgggtatgcatgcgattaaagatcgcccaatggcagttgatggtcaggttgtt
attctacctatgatgtatctagcactttcttatgaccatcgtttaattgatggccgtgag
tctgtcggtttcttagtgaccgttaaagaaatgctagaagatcctgcccgtttattactg
gatgtgtag

DBGET integrated database retrieval system