KEGG   Proteus mirabilis HI4320: PMI0571Help
Entry
PMI0571           CDS       T00753                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00020  Citrate cycle (TCA cycle)
pmr00640  Propanoate metabolism
pmr00660  C5-Branched dibasic acid metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01130  Biosynthesis of antibiotics
pmr01200  Carbon metabolism
Module
pmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PMI0571 (sucC)
   00640 Propanoate metabolism
    PMI0571 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PMI0571 (sucC)
Enzymes [BR:pmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PMI0571 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A HI0933_like
Motif
Other DBs
NCBI-ProteinID: CAR41369
UniProt: B4ESR1
Position
617977..619143
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFSRYGLPAPAGFACSTPREAEEAASKIGQGPWVVKCQVHAGGRGKAGGV
KVVNSKEEIRAFAEQWLGKRLVTYQTDANGQPVTQILVEAATDIAKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHRAIIDPLTGPMPYQGRELAFKLGLKGKQVSQFAKI
FMGLATIFLERDLALIEINPLVITKDDDLICLDGKLGVDSNALFRQPEMREMHDPSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDENVSAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGTKK
LADSGLNIIAAKSLTDAAKQVVAAAEAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacagcttttctcacggtatggattaccagcacct
gctggtttcgcctgctccacgccgcgcgaggcagaagaagctgcatcaaaaattggccaa
ggcccttgggttgttaaatgtcaagttcacgcgggtggacgtggtaaagcgggtggcgta
aaagtcgtcaactcaaaagaagagatccgcgcatttgctgaacaatggttaggcaaacgt
ttagtaacttatcaaacagatgctaatggccaaccagtaacacaaatcttggttgaagct
gcaacagatattgctaaagaactttatcttggtgctgttgttgaccgtggtacccgtcgt
gttgtctttatggcttccactgaaggtggcgttgaaattgaaaaagtggcggaagagacg
ccagagcttattcatcgtgccattattgatccgctgacaggacctatgccttatcaggga
cgagaattagccttcaaactcggtttaaaaggcaaacaagttagtcaatttgctaaaata
tttatgggattagcgacgattttcttagagcgtgatttagcgcttattgagatcaaccca
ttagtgatcaccaaagatgatgatttgatttgtcttgatggtaaattaggtgtggacagt
aatgcgttattccgtcaaccggaaatgcgtgaaatgcatgatccatcacaagaagatcca
cgtgaagcgcaagcggcacaatgggaattaaattatgtagcactcgatggcaatatcggt
tgtatggttaatggcgctggtttagctatgggaaccatggatatcgttaaactgcatggc
ggtgaacctgctaacttccttgatgttgggggaggggcaaccaaagagcgtgttacagaa
gcatttaagattattttgtcagatgaaaatgtcagtgctgtattagtcaacattttcggt
ggcattgtacgttgtgaccttattgcagacggtattattggtgcagttgaagaagtcggt
gttaacgtaccagttgttgttcgtcttgaaggaaacaatgcagagttaggcactaaaaaa
ttagcagatagcggtttaaatattattgctgctaagagcttaacggatgccgctaaacaa
gttgttgcagcagcggaggcaaaataa

DBGET integrated database retrieval system