KEGG   Proteus mirabilis HI4320: PMI0853Help
Entry
PMI0853           CDS       T00753                                 

Gene name
rluC
Definition
23S rRNA pseudouridylate synthase C (EC:5.4.99.-)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
pmr  Proteus mirabilis HI4320
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
945239..946192
Genome map
AA seq 317 aa AA seqDB search
MKSFNQVQFVTIDGDEAGQRIDNFLLARLKGVPKSMIYRIIRKGEVRVNKGRIKPEYKLA
AGDSIRIPPVRVAEKEEHAVSPKLEKVSALAECILYEDEHVMLINKPSGTAVHGGSGLSF
GVIEGLRALRPEARFLELVHRLDRDTSGVLLIAKKRSALRSLHEQLRLKQMQKDYLALVR
GQWQSHTKVVQAPLLKNILQSGERVVKVSSEGKPSETRFKVEERFEFATLVKASPVTGRT
HQIRVHTLHAGHPIAFDDRYGDRDFDTQLASTKLNRLFLHASSLTFIHPSTGEKMRIEAP
MDKTLRYCLQVLRNQKS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatttaatcaagttcagttcgtcaccattgatggcgatgaagcaggccagcgt
attgataattttttactggcacgcttaaaaggtgtaccgaaaagtatgatttaccgaatt
atccgcaaaggtgaagttcgggttaataaagggcgcattaagcctgaatataaattagct
gcaggggatagcattcgtattcctcctgtccgggtagcagaaaaagaagaacatgcggta
tcgcctaagttagaaaaagtatcagcacttgctgagtgtattttatatgaagatgaacat
gtgatgctgattaataagccatcagggacggcagtacatggtggtagcggactcagtttt
ggtgtgattgaaggtttaagggcattgcgcccagaagcgagatttctagaattagtgcat
cgccttgatagagatacctcaggggtattgttgattgctaaaaagcgctcagccctgcgt
tcactacacgaacagctaagattaaaacagatgcaaaaagattatttagccttagtacgt
ggtcaatggcaatctcatacaaaagtagtacaagcccctttattgaaaaatatcctacaa
agtggtgagcgggtggttaaagtaagtagtgaaggtaaaccatcagaaacacgctttaag
gtagaagagcgctttgaatttgcgaccttagttaaagcaagtcctgtcacgggacgaact
catcaaattcgtgtccatacattacatgccggccatcctattgcttttgatgatcgctat
ggtgatcgtgattttgatacacaattagcttcaaccaagcttaatcgtctctttttacat
gcgagttcattaacctttattcatccctcaacaggggaaaaaatgcgtattgaagcgccg
atggataaaacgttacgttactgtttacaagtattacgcaatcaaaaatcttaa

DBGET integrated database retrieval system