KEGG   Proteus mirabilis HI4320: PMI0873Help
Entry
PMI0873           CDS       T00753                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmr  Proteus mirabilis HI4320
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pmr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960509..961528
Genome map
AA seq 339 aa AA seqDB search
MGPVMLDVEGYELDNEEREILKHPLVGGLILFTRNFHDAEQLNELVRQIRDASHERLVIA
VDQEGGRVQRFRDGFTRLPAAQSYAALNERYQASRLAQEAGWLMASEMIAMDIDISFAPV
LDLGHDCIAIGERSFHECPEIAMDMAESFIKGMRSAGMKSTGKHFPGHGAVRADSHKETP
RDERSLNDIRQRDMAIFKDFIQRQLLDAIMPAHVIYSQIDERPASGSPYWLKSILREQLG
FQGVIFSDDLSMEGAAIMGSYAQRAQRSLDAGCDMLLVCNNRKGAVSVLDNLSFVKAERI
SALYHHRGRYTLSELQASDRWKKANQMLTQLQEQWQERA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctgtaatgcttgatgttgaaggatatgagctcgataacgaggagcgtgaaatt
ttaaagcatccccttgttggtggtttgatcctctttacccgcaacttccacgacgctgag
cagttaaatgaattagtgcgccaaatccgtgatgcttcccatgagcgtttagtgattgcc
gttgaccaagaaggagggcgagtacagcgctttcgtgatggttttactcgcttacctgcc
gcgcaatcttatgctgcgcttaatgagcgctatcaagctagtcgcttagcacaagaggcc
ggttggttaatggcatcagaaatgatcgcaatggatattgatattagctttgctcctgtc
ctagatcttggtcatgactgtattgctatcggtgagcgctctttccatgagtgtccagaa
atcgctatggatatggcggaaagctttattaaaggaatgcgctctgcaggtatgaaatca
acaggtaagcattttcctggtcatggtgcagtcagagccgattcccataaagaaacgcca
cgtgatgagcgctctttaaacgatattcgtcaacgtgatatggctatctttaaagatttt
atccaacgtcaattattagatgccattatgccagctcatgttatttattctcagattgat
gagcgtccagcaagtggctctccttattggttgaaatcaattttacgtgaacaactcggt
ttccaaggcgttattttctcagatgatttatctatggagggtgccgctattatgggaagt
tatgcgcagagagcacaacgttcattagatgcgggttgtgatatgcttttagtgtgtaat
aaccgtaaaggggcggtaagtgtgttagataacctgtcctttgtcaaagcagaacgcatt
tcggcgttgtaccatcaccgaggtcgttacacattaagtgaactgcaagcatctgatcgt
tggaaaaaagcgaatcaaatgctgacccaattacaggagcaatggcaggagcgcgcatga

DBGET integrated database retrieval system