KEGG   Proteus mirabilis HI4320: PMI1115Help
Entry
PMI1115           CDS       T00753                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMI1115 (ruvA)
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMI1115 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183518..1184141
Genome map
AA seq 207 aa AA seqDB search
MIGRIRGVILEKQPPVVLIEAGNGVGYEINMPMTCFYELPDIGQEAIIYTQFIVREDAQL
LYGFNQKQERALFRELIKVNGVGPKLALAILSGMSARQFVTAIENESISSLVKLPGVGKK
TAERLVVEMKDRFKGLNGDLFEQNGDIELPASASSKAPSAADIEAEASAALIALGYKPQE
AAKMISRVATAGADSETLIKEALRAAI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgataggacgtattagaggcgttattcttgaaaaacagccaccagtggtgctgatcgaa
gcgggtaatggggtgggttatgaaataaatatgcctatgacctgtttttatgagttacct
gatattggtcaagaggcgattatctacacacaatttattgttcgtgaagatgcgcaatta
ctatatggttttaatcaaaaacaagaacgggcattgtttcgtgaattgataaaagtcaat
ggtgtagggcctaagctagcactggctattttatcaggaatgtctgcacgccaatttgtc
accgcaattgaaaatgaatccatctcctcattagttaaattaccgggagtcggtaaaaaa
accgcagaacgattagtggttgaaatgaaagatcgcttcaaagggcttaatggcgatcta
tttgaacaaaacggcgatattgagctaccagccagtgcatcatcgaaagcgccatctgct
gcagatattgaagcagaagcttccgctgccttaattgccttaggttataaaccacaagaa
gctgccaagatgattagtcgggtagcaacggcgggtgctgatagtgaaacacttatcaaa
gaagcattacgcgcagcgatttag

DBGET integrated database retrieval system