KEGG   Proteus mirabilis HI4320: PMI1273Help
Entry
PMI1273           CDS       T00753                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pmr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1348824..1350140)
Genome map
AA seq 438 aa AA seqDB search
MSYFDKIEQIQYEGTTSDNPLAFRYYNPDEIILGKRMEDHLRFAACYWHNFCWNGSDMFG
IGTFDRPWQTPGEALEQAKRKADVAFEFFHKLNVPFYCFHDVDVISEGNSINEYITNMAA
ITEVLAQKQQETGVKLLWGTANCFTHPRYGAGAATNPDPEVFAWAATQVCEAMKATKTLG
GENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKH
QYDYDTATVYGFLKQFGLEKEVKVNIEANHATLAGHSFHHEIATAIALGILGSVDANRGD
PQLGWDTDQFPNSVEENALVMYEILKSGGFTTGGLNFDAKVRRQSNDKYDLFYGHISGMD
TMAMALRIAARMIQDGGLDKFIAQRYAGWSAELGQNILQGKLSLEEVAKYAQSNTLAPRL
QSGRQEMLESLVNRYIFG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactttgataaaattgaacaaattcaatatgaaggtaccaccagcgataaccct
ctcgcttttcgctactataatccagatgaaattattttagggaaaagaatggaagatcat
ctgcgatttgctgcctgctattggcataacttctgctggaatggttcggatatgtttggt
attggtacgtttgatagaccttggcagacaccgggagaagcactagaacaagcaaagcgt
aaagcggatgttgcttttgaatttttccataaactcaatgtacctttttactgttttcat
gatgttgatgttatctctgaaggaaatagcattaatgaatatatcaccaatatggcagca
ataactgaggtattagcgcaaaaacagcaagaaacgggcgttaaattattatggggaact
gcaaattgttttactcatcctcgttacggagctggtgctgcaacaaatcctgatccagaa
gtatttgcttgggcggcaactcaagtttgtgaagcgatgaaagcaacaaaaacgctggga
ggcgaaaactatgtgttatggggaggccgcgaaggttacgaaacattattaaatacagat
ttacgccaagagcgggaacaaattggtcgttttatgcagatggttgttgagcataaacat
aaaattggattccaaggtacactgctcatcgagccgaagccacaagagccaactaagcat
caatatgattatgatactgcgacagtttatggtttcttaaaacaatttggcttagaaaaa
gaagttaaagtgaacatagaagctaaccatgcaactttagcgggtcacagtttccatcat
gaaatcgccacagctattgcattaggtattttaggctcagtcgatgctaaccgaggtgat
ccacaattaggttgggacacagaccaattccccaatagtgtagaagaaaatgcattagtt
atgtatgaaattctcaaatccggtggttttacgactggtggattaaactttgatgccaaa
gtacgtcgtcaaagtaatgataaatacgatcttttctatgggcatatatccggaatggac
accatggcaatggcattacgtattgcagcaagaatgatccaagacggtggacttgataaa
tttattgctcaacgttatgcgggatggagtgctgaacttggccaaaatatcctacaaggc
aaattaagtcttgaagaagtggcaaaatatgcacaaagcaataccttagcgccccgctta
caaagcggacgtcaagagatgctagagagtttagtgaatcgttatatttttggttaa

DBGET integrated database retrieval system