KEGG   Proteus mirabilis HI4320: PMI1346Help
Entry
PMI1346           CDS       T00753                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMI1346 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMI1346 (trpC)
Enzymes [BR:pmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PMI1346 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PMI1346 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1424761..1426134
Genome map
AA seq 457 aa AA seqDB search
MTVLNAIVKDKAEYLVARKAQQPLSTFIDKIAPSTRSFYQALTQSHPVFILECKKASPSK
GIIRSDFDPVAIAKIYQPYAAAISVLTDEKYFQGSFDYLRQVSDAVHQPVLCKDFIIDEY
QIYLARFYQADAILLMLSVLNDEQYRALSAVAHQLNMGVLTEVSTEEERQRAIELKAKVI
GINNRNLRDLSIDLSRTEQLSQGLPQEAIVISESGIHTHQQVKTLSQYANGFLVGSALMS
QENIAQAVRALILGKHKVCGLTRTQDVKAAYQAGAYYGGLIFAEKSPRRVTLSQAQLLVT
QAPLAFVGVFQNQSIELICDYAKQLNLSAVQLHGAEDAQFIAQLREKIAPQCEIWQALNM
AYHHDIQHIAQVNKYVLDNGTGGTGNTFDWQTIPPTLRHKALLAGGLNSDNCLDALNTGC
LGLDFNSGVESSAGIKDPQRLSQVFTQLQQSKFSQNF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgactgtattaaatgccattgttaaagataaagccgaatatttagttgcacgtaaagca
cagcaacctttatcaacctttatagataagattgcgccatcgacacgctcattttatcaa
gcattaacgcaatcacacccagtgtttattttagagtgtaaaaaagcatcgccctcaaaa
gggattattcgctctgattttgatcccgttgccattgcgaaaatttatcaaccctatgca
gccgctatttcggtactgactgatgaaaaatattttcaaggcagttttgattatttacgt
caagtgagtgatgccgttcatcaacctgttttatgtaaagattttattatcgatgaatac
caaatttatttagctcgtttttaccaagctgatgccattttattaatgctttctgttctt
aatgatgaacagtaccgtgcgcttagtgccgttgctcaccaattaaacatgggagtatta
acagaagtgagcaccgaagaagagcgtcagcgagccattgagcttaaagcaaaagtgatc
gggattaataatcgtaatttacgtgatctctctattgatttatcccgtaccgaacaactt
agccaaggtttaccgcaagaggctattgttatcagcgaatctggaattcatacccatcaa
caagttaaaacactaagtcaatatgctaatggctttttagtgggtagtgccttgatgtca
caagagaatattgcccaagcggtaagagcacttattttgggaaagcataaagtgtgcggc
ttaacccgtacacaagatgttaaagcggcctatcaagcgggtgcctattatggaggatta
atttttgctgagaaatcaccacgaagagtgacactgtcacaagcacaattattggtaaca
caagcgccattagcttttgtgggcgtttttcaaaaccaatctattgagcttatttgtgac
tatgctaaacaacttaatttatctgcggttcagttacatggcgctgaagatgcacaattt
atagcccaactaagggaaaaaatcgccccacaatgtgaaatttggcaagcgcttaatatg
gcttatcaccatgatattcagcacattgcgcaagttaacaaatatgtattagataatggt
acaggtggcacaggcaacacctttgattggcaaactattccgcctactttacgccataaa
gcattacttgcaggtggcctaaacagtgataactgtttagatgctctaaacaccggttgc
ttaggacttgattttaattcaggggtggaatcttcagcaggtatcaaagatccacaacgt
ctatcgcaagtctttacacaattacaacaaagcaaattttcacaaaatttctga

DBGET integrated database retrieval system