KEGG   Proteus mirabilis HI4320: PMI1347Help
Entry
PMI1347           CDS       T00753                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMI1347 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMI1347 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMI1347 (trpB)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMI1347 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1426151..1427341
Genome map
AA seq 396 aa AA seqDB search
MRKLNPYFGEFGGQYVPEILIPALDQLEQAFIDAQNDPSFQQEFQDLLKNYAGRPTALTL
CRNLTQGTRTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLNMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGCY
ERAHYLLGTAAGPHPYPTIVREFQRMIGDEAKAQILAREGRLPDAVIACIGGGSNAIGLF
ASFIPETSVQLIGVEPAGKGIETGEHGAPLKHGKLGIYFGMKSPIMQTEEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDDEAIEAFKTLSRREGIIPALESSHALAYALKL
IAQNPDKEQLLIVNLSGRGDKDIFTVNDILAARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacttaatccctactttggtgagtttggtggtcaatatgtaccagaaatattg
atccctgcattagatcaacttgaacaagcctttattgacgcacaaaacgatccgtcattt
cagcaagagtttcaagatctactcaaaaattatgcaggtagaccaacggcactgacactc
tgtcgcaatttgacccaaggtactcgtacccgtttatatctaaaacgtgaagatttattg
catggcggtgctcataaaacaaaccaagtattaggccaagcactgctagcaaaacggatg
ggaaaaacagaaattattgcagaaacgggcgctgggcaacatggtgttgccactgcgtta
gcttgtgccctgttaaatatgaagtgccgtatttatatgggggcaaaagatgttgaacgt
caatcacccaatgtatttcgtatgcgtttaatgggtgccgaagttattccggtgcatagt
ggttcatcaacattaaaagatgcgtgtaatgaagcgttacgtgactggtctggttgctac
gagcgtgctcactacttattaggcactgcggcaggcccgcatccttatcccactattgtt
cgcgaattccagcgcatgattggggatgaagctaaagcgcaaattttagcccgtgaaggt
cgtctccctgatgccgttatcgcctgtattggcggtggctctaacgccattggcttattc
gcctcatttataccagaaacctcagtacaattaattggtgttgagccggcaggaaaaggg
atcgaaacaggagagcacggagcaccattaaaacatggcaagttaggcatttatttcggt
atgaaatcaccgattatgcaaaccgaagaaggccaaattgaagagtcctattctatttct
gcaggattagatttcccatccgtaggcccgcaacatgcgcatttaaacagcattggccgt
gcagattatgtttctgtaacagatgatgaagccattgaggcttttaaaacgctatcacgc
cgtgaagggatcatccccgcattagaatcgtcacatgctctggcctatgcgttgaaactg
attgcccaaaatccagataaagaacaactcttaattgtcaatttatccggacgaggtgac
aaagatatttttactgttaacgatattttagctgcacgaggagaaatttaa

DBGET integrated database retrieval system