KEGG   Proteus mirabilis HI4320: PMI1348Help
Entry
PMI1348           CDS       T00753                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00260  Glycine, serine and threonine metabolism
pmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01130  Biosynthesis of antibiotics
pmr01230  Biosynthesis of amino acids
Module
pmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMI1348 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMI1348 (trpA)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMI1348 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: CAR42850
UniProt: B4EWH8
Position
1427341..1428150
Genome map
AA seq 269 aa AA seqDB search
MSRYQLCFEALAQKQQGAFVPFVTLGDPDAELSLKIIDALIEGGADALEIGIPFSDPLAD
GPTIQGANLRALNANVTPTLCFELLSQIRQKHPTIPIGLLVYANLVFSNGVDNFYHKCQQ
AGVDSVLIGDVPLREAKQFREAALSANIAPIFICPPNADDELLQELATSAEGYTYLLSRA
GVTGTDKRAEQSLTHLTSKLKAYNAPPALQGFGISEPQQVSQAISNGAFGAISGSAVVQI
IENNLHQPDVMLKMLTQFVQQMKAATISV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttatcaattatgctttgaagcattagcacaaaaacaacaaggcgcgtttgtt
ccctttgtcactttaggtgatcccgatgctgaactgtcgttaaaaattattgacgcatta
attgaagggggtgcagatgcgttagagataggcattccattttctgatccactggctgat
ggccctactattcaaggggcaaacttacgggcattaaatgctaatgtcaccccaaccctc
tgttttgagttattaagccagatccgccaaaaacaccccactattccgattggactattg
gtgtatgcaaatcttgtttttagcaatggcgttgataatttttaccataaatgccaacaa
gcgggtgttgattcagtactgattggtgatgttcccttgcgtgaagcaaaacaatttcga
gaagcggcattaagcgcgaatattgccccgatttttatttgcccgcccaatgcagatgat
gagttattacaagagttagccaccagcgcagagggatatacttatctattatcaagagcc
ggtgttacggggacagataaacgagcagaacagtcactcactcatttaaccagtaaactt
aaagcttataatgcaccacctgcattacaaggttttggtatttctgagccacaacaagtt
tcacaggccattagtaatggtgcatttggcgctatctcaggatcagccgttgtacaaatt
attgaaaataacctacatcaacctgatgtgatgttaaaaatgttgacgcagtttgtgcaa
caaatgaaagccgcaacaataagcgtttaa

DBGET integrated database retrieval system