KEGG   Proteus mirabilis HI4320: PMI1455Help
Entry
PMI1455           CDS       T00753                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMI1455 (hemB)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PMI1455 (hemB)
Exosome [BR:pmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMI1455 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535091..1536068
Genome map
AA seq 325 aa AA seqDB search
MSNEQSIQRLRRLRQSENLRALFQETTLSKNDLALPIFVEEGLEDYQPIKSMPGVVRIPE
KRLAYEIERIAKAGIKTVMTFGVSHHLDETGSDAWKSDGLVSRMSRICKDAVPEMIVMSD
TCFCEYTSHGHCGVLHGEHVDNDETIHNLGLQAVAAAQAGADFIAPSAAMDGQVAAIRAA
LDQAGFTDTGIVSYSTKFASALYGPFRDAAGSRLIGDRKTYQMNPMNRREAIRESLIDEQ
EGADMLMVKPAGAYLDIIRDVRERTLLPLAAYQISGEYAQIKFAALAGAIDEDRVVMETL
GSIKRAGADLILSYFALDLAERNLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaacaatccatccagcgattaagaagactacgccagtcagagaacctgcgc
gcgctgtttcaagaaacgacactcagcaaaaatgatctagccctacctattttcgttgaa
gaaggcttagaggattatcagccgatcaaaagtatgccaggtgtggtacgtattcctgaa
aaacgccttgcttatgaaattgagcgtatcgctaaagcgggtatcaaaacggtcatgacc
tttggtgtctcacaccatcttgatgaaacaggtagcgacgcttggaaaagcgacggtcta
gtttctcgcatgtctcgtatttgtaaagatgctgtaccagaaatgattgttatgtcagat
acttgtttctgtgaatatacttcacacggacactgtggcgttttacatggtgaacatgtc
gataatgatgaaactatccataatttaggtctacaggcggttgccgccgcacaagctggt
gctgattttattgctccctctgccgcaatggatggtcaagttgccgctattcgtgctgca
ttagatcaagcaggatttaccgataccggtattgtttcctactcaactaaatttgcttct
gcattatatggcccattccgtgatgctgctggctctcgcttaattggtgatcgtaaaaca
tatcaaatgaatccgatgaatcgtcgggaagctatccgcgaatcattgattgatgagcaa
gaaggtgcggatatgttaatggttaagcctgctggtgcttatttagatattattcgtgat
gttcgtgaacgtacactattaccgttagcagcctaccaaattagtggggagtatgcgcaa
atcaaatttgctgcattagcgggtgctatcgatgaagatcgcgtggtaatggaaacacta
ggctccattaaacgcgcaggtgctgatttaattctctcttactttgcgcttgatttagca
gaaagaaatctactttaa

DBGET integrated database retrieval system