KEGG   Proteus mirabilis HI4320: PMI1490Help
Entry
PMI1490           CDS       T00753                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PMI1490 (galU)
   00052 Galactose metabolism
    PMI1490 (galU)
   00500 Starch and sucrose metabolism
    PMI1490 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PMI1490 (galU)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PMI1490 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580586..1581491)
Genome map
AA seq 301 aa AA seqDB search
MSSVVRKVRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEVQGICPSHVTIMQTRQGIAKGLGHAIL
CAKPLVGDEPFAVILPDVILDRYSADLTKVNLKEMLSHFEQSGASQILVEPVPEEEVSNY
GIVDCMGEHLQPGDSKPITRVVEKPKKEEAPSNLSIVGRYVLSENIWPLLAKTAPGAGDE
IQLTDAIAMLIEKEPVEAYHLQGKSHDCGNKLGYMKAFVEYGLQHEEFGEEFTKWIKSLQ
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagtggtgcgtaaagtaagaaaagcggtgatccctgttgcagggctaggaaca
agaatgttgcctgccaccaaggctatcccaaaagagatgctacctgttgttgataaacct
ttaattcaatatgttgttaatgaatgtattgcagctggcatcaatgaaattgtgctagtt
acacactcttcaaaaaattctattgaaaaccattttgataccagttttgaattagaagct
attttagaaaaacgagttaaacgtcagttgttggaagaagtacaaggtatttgtccaagt
cacgttactattatgcaaactcgccaaggaatagcaaaagggttaggccatgccatttta
tgtgcaaaacctttggtgggtgatgagcctttcgctgttatcttgccggatgttatttta
gaccgatatagtgctgatctgactaaggttaatttaaaagagatgctttctcattttgaa
caatctggcgcaagtcaaattttagtagagcctgttcctgaagaggaagtatctaactac
gggattgttgactgcatgggagaacatttacagcctggcgacagtaaacccattactcgt
gtggtagaaaaaccgaagaaagaagaagcaccttcaaatttatctattgttggtcgttat
gtgttgtctgaaaacatttggcctttattagccaaaacggcaccaggagcaggggatgaa
attcaattaactgacgcgattgcaatgttaattgaaaaagagcctgtagaagcttatcac
ctacaagggaaaagccacgattgtggtaataaattaggttatatgaaagcttttgttgaa
tatggtttacagcacgaagagtttggcgaagagttcacgaaatggataaaatcactgcaa
gcttaa

DBGET integrated database retrieval system