KEGG   Proteus mirabilis HI4320: PMI1490Help
Entry
PMI1490           CDS       T00753                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pmr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580586..1581491)
Genome map
AA seq 301 aa AA seqDB search
MSSVVRKVRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEVQGICPSHVTIMQTRQGIAKGLGHAIL
CAKPLVGDEPFAVILPDVILDRYSADLTKVNLKEMLSHFEQSGASQILVEPVPEEEVSNY
GIVDCMGEHLQPGDSKPITRVVEKPKKEEAPSNLSIVGRYVLSENIWPLLAKTAPGAGDE
IQLTDAIAMLIEKEPVEAYHLQGKSHDCGNKLGYMKAFVEYGLQHEEFGEEFTKWIKSLQ
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagtggtgcgtaaagtaagaaaagcggtgatccctgttgcagggctaggaaca
agaatgttgcctgccaccaaggctatcccaaaagagatgctacctgttgttgataaacct
ttaattcaatatgttgttaatgaatgtattgcagctggcatcaatgaaattgtgctagtt
acacactcttcaaaaaattctattgaaaaccattttgataccagttttgaattagaagct
attttagaaaaacgagttaaacgtcagttgttggaagaagtacaaggtatttgtccaagt
cacgttactattatgcaaactcgccaaggaatagcaaaagggttaggccatgccatttta
tgtgcaaaacctttggtgggtgatgagcctttcgctgttatcttgccggatgttatttta
gaccgatatagtgctgatctgactaaggttaatttaaaagagatgctttctcattttgaa
caatctggcgcaagtcaaattttagtagagcctgttcctgaagaggaagtatctaactac
gggattgttgactgcatgggagaacatttacagcctggcgacagtaaacccattactcgt
gtggtagaaaaaccgaagaaagaagaagcaccttcaaatttatctattgttggtcgttat
gtgttgtctgaaaacatttggcctttattagccaaaacggcaccaggagcaggggatgaa
attcaattaactgacgcgattgcaatgttaattgaaaaagagcctgtagaagcttatcac
ctacaagggaaaagccacgattgtggtaataaattaggttatatgaaagcttttgttgaa
tatggtttacagcacgaagagtttggcgaagagttcacgaaatggataaaatcactgcaa
gcttaa

DBGET integrated database retrieval system