KEGG   Proteus mirabilis HI4320: PMI1663Help
Entry
PMI1663           CDS       T00753                                 

Gene name
cheB
Definition
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr02020  Two-component system
pmr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PMI1663 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PMI1663 (cheB)
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PMI1663 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     PMI1663 (cheB)
Two-component system [BR:pmr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PMI1663 (cheB)
Bacterial motility proteins [BR:pmr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PMI1663 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: CAR43471
UniProt: B4EYP8
Position
complement(1773659..1774711)
Genome map
AA seq 350 aa AA seqDB search
MNKITVLCVDDSALMRQIMREIINSHHDMEVVDCAPDPIVARDLIKKFNPQVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMVSSLTAKGSEVTLKALELGAVDFVTKPQLGLREGMLAYS
ELIAEKIRAAAQARISRHETKTLPSKSLSFTPMISSEKLIAVGASTGGTEAIRHFLEPLP
ITSPAVLITQHMPAGFTHSFAERLNRLCQISVKEAEDGERVLPGHAYIAPGDYHMELRRN
GANYQIHINKDPAVNRHRPSVDVLFNSVAKYAGRNAIGVILTGMGSDGATGLLAMRRAGS
YTFAQDEASCVVFGMPRSAVELGAVDEVKSISSMSKAVLMKISTTQSLRI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataacggtactctgtgttgatgattcggcgttaatgcgccagatcatgcga
gaaataattaatagtcaccatgatatggaggtcgttgattgtgcgccagatccgatagtc
gctcgtgacttaataaaaaagtttaatccacaggtattgacgttagatgttgaaatgcca
cgcatggatggtattgattttttggaaaaattaatgcgcttacgccctatgccagtggtg
atggtttcatcactcacagccaaaggttcagaagtgacattaaaagcattagaactgggg
gcggttgattttgtcactaaacctcagttaggtctacgtgaaggaatgttggcctacagt
gaacttattgcagaaaaaattcgagcagcggctcaggcaagaattagtcgtcatgaaacg
aaaacattaccgtctaagtcgttatcatttactcccatgatttcgagtgaaaagttaatc
gctgttggtgcttcaacagggggcaccgaggctattcgtcattttttagagccattacct
attaccagtcctgcagtattaataacccaacatatgccggcggggtttacccactcattt
gcagagcggttaaaccgtttatgccaaatcagtgtgaaagaagctgaagatggagaaagg
gttttacctggacacgcctacatcgcaccgggtgattatcatatggagcttcgtcgtaat
ggtgctaattaccagatccatataaataaagatcctgcggtaaatcggcatcgaccttct
gttgatgtgctatttaattcggttgctaaatatgcggggcgtaatgctattggtgtcatt
ttaacagggatgggcagtgatggtgctacaggtttattagcaatgcgtcgtgcaggtagc
tacacatttgcacaagatgaagcaagctgcgtcgtctttgggatgcctcgttccgcggtc
gaattgggagccgtagatgaggtaaaaagtataagctcaatgagtaaagccgtgctgatg
aaaatcagcacaacacaatcattgcgtatctga

DBGET integrated database retrieval system