KEGG   Proteus mirabilis HI4320: PMI1746Help
Entry
PMI1746           CDS       T00753                                 

Gene name
menF
Definition
menaquinone-specific isochorismate synthase (EC:5.4.4.2)
Orthology
K02552  
menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Biosynthesis of siderophore group nonribosomal peptides
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:pmr00130]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of siderophore group nonribosomal peptides [PATH:pmr01053]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1869555..1870883)
Genome map
AA seq 442 aa AA seqDB search
MEKVNPVFSTLYEKVKNINLTAQDDLLHLKVILPSEVSFSLLSWLAAQTYYPQFYWQHRD
ESEEVAVCGQVKCFNHIRDAHRFLATHRHSLHADDVRIWGLNAWDTIIPGRIDKERGDDA
YLFLPRIEIRRQQQLSIHINLLAEEDKQSALAFIRSLKNALNIAPLSVKVTSVEHSLTQQ
QWTDYLNIALDEINQGVFEKVVPARATCLSLDNPLKAIQFMKASRDVNHHCYHYMLAFSP
TDAFMGSSPERLYKRDEFVLYTEALAGTVASSDNEQQAIAFADWLMNDKKNQHENLVVVD
DICQRLQGGIEGIDVSSADVIRLRKVQHLRRYIHGKLIHADDVDCLQRLQPTAAVCGLPR
SIARTFIRQHEPFERRWYAGSAGYLSLPHAEFAVSLRCGELHDDALTLYAGAGVVAGSDP
LQEWAEIENKAAGLRTLLEKEC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaggttaatcctgtgttttcgacactgtacgaaaaagttaaaaatataaatctg
acagcacaagatgatcttttacatttgaaagttatcttgccatcagaggtgtcattttcc
ttactttcatggctagcagcacaaacgtattacccgcaattttattggcaacatcgtgat
gaaagcgaagaagtagccgtttgtggacaagttaagtgctttaatcatatccgtgatgct
catcgatttttagcaacacatcggcattcattgcatgctgatgatgtgcgtatttgggga
ttaaacgcgtgggataccattattccagggcgtattgataaagaaaggggggatgatgct
tacctttttttacctcgtattgaaataagacgtcagcaacaactgtcgatccatattaat
ttattggcagaagaagataagcaaagtgcgcttgcttttattcgctcacttaaaaatgca
ctgaatattgcacctttatctgtcaaagtaacatctgtagagcactcgttaacgcaacag
caatggactgactatcttaatattgctttagatgaaatcaatcaaggcgtatttgaaaaa
gtagtacctgcacgggcaacctgcttaagcttagataatccgttaaaagctattcaattt
atgaaagcaagtcgagatgttaatcatcattgctatcattatatgctggctttttcacct
actgatgcttttatgggctcatcaccagaaagattgtataaacgcgatgaatttgtgctt
tataccgaagcgttggcgggcactgtggcaagttctgataatgaacaacaggccatagca
tttgctgattggctaatgaacgataaaaaaaatcaacatgaaaatctggtggtagttgat
gatatttgtcagcgattacaaggtgggatagaagggattgatgtatcatcagcagatgtg
atccgcttacgtaaagtgcaacatctgcgtcgctatatccacggtaaacttatccatgct
gatgatgtggattgtttacagcgtttacaacctaccgcggctgtttgtggcttaccgcgc
tctattgcgcgcacttttattcgtcaacatgaaccttttgaacgccgttggtatgctggc
tctgcgggctatttgtctttgcctcatgccgaatttgcggttagcctgcgttgcggtgaa
ttgcatgatgatgcattaacgctttatgctggcgcaggggtggttgcgggatctgatcct
ttgcaagagtgggctgaaattgaaaataaagcagcaggtttacgcactttattagaaaaa
gagtgttga

DBGET integrated database retrieval system