KEGG   Proteus mirabilis HI4320: PMI1746Help
Entry
PMI1746           CDS       T00753                                 

Gene name
menF
Definition
menaquinone-specific isochorismate synthase (EC:5.4.4.2)
Orthology
K02552  
menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Biosynthesis of siderophore group nonribosomal peptides
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PMI1746 (menF)
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    PMI1746 (menF)
Enzymes [BR:pmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     PMI1746 (menF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1869555..1870883)
Genome map
AA seq 442 aa AA seqDB search
MEKVNPVFSTLYEKVKNINLTAQDDLLHLKVILPSEVSFSLLSWLAAQTYYPQFYWQHRD
ESEEVAVCGQVKCFNHIRDAHRFLATHRHSLHADDVRIWGLNAWDTIIPGRIDKERGDDA
YLFLPRIEIRRQQQLSIHINLLAEEDKQSALAFIRSLKNALNIAPLSVKVTSVEHSLTQQ
QWTDYLNIALDEINQGVFEKVVPARATCLSLDNPLKAIQFMKASRDVNHHCYHYMLAFSP
TDAFMGSSPERLYKRDEFVLYTEALAGTVASSDNEQQAIAFADWLMNDKKNQHENLVVVD
DICQRLQGGIEGIDVSSADVIRLRKVQHLRRYIHGKLIHADDVDCLQRLQPTAAVCGLPR
SIARTFIRQHEPFERRWYAGSAGYLSLPHAEFAVSLRCGELHDDALTLYAGAGVVAGSDP
LQEWAEIENKAAGLRTLLEKEC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaggttaatcctgtgttttcgacactgtacgaaaaagttaaaaatataaatctg
acagcacaagatgatcttttacatttgaaagttatcttgccatcagaggtgtcattttcc
ttactttcatggctagcagcacaaacgtattacccgcaattttattggcaacatcgtgat
gaaagcgaagaagtagccgtttgtggacaagttaagtgctttaatcatatccgtgatgct
catcgatttttagcaacacatcggcattcattgcatgctgatgatgtgcgtatttgggga
ttaaacgcgtgggataccattattccagggcgtattgataaagaaaggggggatgatgct
tacctttttttacctcgtattgaaataagacgtcagcaacaactgtcgatccatattaat
ttattggcagaagaagataagcaaagtgcgcttgcttttattcgctcacttaaaaatgca
ctgaatattgcacctttatctgtcaaagtaacatctgtagagcactcgttaacgcaacag
caatggactgactatcttaatattgctttagatgaaatcaatcaaggcgtatttgaaaaa
gtagtacctgcacgggcaacctgcttaagcttagataatccgttaaaagctattcaattt
atgaaagcaagtcgagatgttaatcatcattgctatcattatatgctggctttttcacct
actgatgcttttatgggctcatcaccagaaagattgtataaacgcgatgaatttgtgctt
tataccgaagcgttggcgggcactgtggcaagttctgataatgaacaacaggccatagca
tttgctgattggctaatgaacgataaaaaaaatcaacatgaaaatctggtggtagttgat
gatatttgtcagcgattacaaggtgggatagaagggattgatgtatcatcagcagatgtg
atccgcttacgtaaagtgcaacatctgcgtcgctatatccacggtaaacttatccatgct
gatgatgtggattgtttacagcgtttacaacctaccgcggctgtttgtggcttaccgcgc
tctattgcgcgcacttttattcgtcaacatgaaccttttgaacgccgttggtatgctggc
tctgcgggctatttgtctttgcctcatgccgaatttgcggttagcctgcgttgcggtgaa
ttgcatgatgatgcattaacgctttatgctggcgcaggggtggttgcgggatctgatcct
ttgcaagagtgggctgaaattgaaaataaagcagcaggtttacgcactttattagaaaaa
gagtgttga

DBGET integrated database retrieval system