KEGG   Proteus mirabilis HI4320: PMI1807Help
Entry
PMI1807           CDS       T00753                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMI1807 (fadJ)
   01212 Fatty acid metabolism
    PMI1807 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PMI1807 (fadJ)
   00650 Butanoate metabolism
    PMI1807 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PMI1807 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PMI1807 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PMI1807 (fadJ)
   00310 Lysine degradation
    PMI1807 (fadJ)
   00380 Tryptophan metabolism
    PMI1807 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PMI1807 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PMI1807 (fadJ)
   00281 Geraniol degradation
    PMI1807 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PMI1807 (fadJ)
Enzymes [BR:pmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PMI1807 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PMI1807 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PMI1807 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1936643..1938811)
Genome map
AA seq 722 aa AA seqDB search
MATQQRIQTSSEKSPVFQFSVRPDKVGIITINVVDEKVNTLKAAFVEQFQNVLKQAQQHS
GVKGLIITSGKPDNFIAGADISMIADCKTKEEATALAKAGQDLFTQLENYPLPVVAAING
ACLGGGLELALACHGRICSDNSKTRLGLPEVQLGLLPGSGGTQRLPRLIGVTTALDMILT
GRQINAKRAFKLGLVDDVVPQAILLDVAAQWILTAKKAAKKQTIMERFWANTTLGRNILF
DQAKKRTLAKTKGHYPAAERILHVIERGLEKDIQTGFKEEANAFGELAMTPVSSALRHLF
FASTALKNETGSSAKPDNLHHIGILGGGLMGGGIAFVTATKGNLPVRIKDISDKGIAQAL
NYSWKALSTKVKKKRLSARERQRQMGLLSGTLDYSGFHQTNLIVEAVFEDLALKQKMVAD
IEALGEGKIIFASNTSSLPIHKIAEKAQYPEKIIGLHYFSPVEKMPLVEVIPHEKTDAKT
IATTVAFAKKQGKVAIVVGDKPGFYVNRILAPYISEALTCLVEGETIENIDKALVQFGFP
VGPIQLLDEVGIDIGTKITPILVNEFGERFASPPAVDAIIADDRKGRKNGRGFYLYNQHA
LPFSLGKNKKRADPMIYRLLQVKPKNQLSASEITERCLLLMLNEAVRCLDENIIQQPRDG
DIGAVFGIGFPPFFGGPFRYIDSMGTTKIVDKLNQLTEKYGEKFQPCERLAAMAELNERF
YS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaacaaaggatacaaacctcatcagagaaatcaccggtattccagttttca
gtgcgtcccgataaggtcggaattatcaccattaatgttgtagatgaaaaggtcaataca
ctgaaagctgcttttgttgaacagtttcaaaatgtattaaaacaggctcagcaacattca
ggtgtaaaaggattaattatcacctcaggtaaacctgataattttattgctggtgctgat
atatcaatgattgcagattgcaaaaccaaagaagaggccaccgcattagcaaaagcagga
caagatctttttactcaattagaaaattatcctttgcctgtcgtcgcagccatcaatggc
gcctgtttaggtgggggattagaactagcattagcctgccatgggcgaatttgctccgat
aacagtaaaacacgtttaggccttcctgaagttcaattaggattactaccaggttcgggg
ggaacccaaagattaccacgtttaataggggttacaaccgccttagatatgattttaact
ggacgacaaattaatgccaaacgggctttcaagcttggcttagttgatgacgttgtacca
caagctattttattagatgttgcagcccaatggattttaacagctaaaaaagctgctaaa
aaacagactattatggagcgtttttgggcaaataccacattaggaagaaatatcctcttt
gatcaagctaaaaagcgcactttagctaaaaccaaaggtcattacccagcggcagagcgt
attcttcacgttattgaacgaggcttagagaaagatattcaaacaggttttaaagaagaa
gctaatgcgtttggtgaattagccatgaccccggtttcatctgcattacggcatctcttt
tttgcctcaacagcattgaaaaatgaaacaggatcatctgcaaagccagataacttacac
catataggtattttaggtggggggttaatggggggcggtattgcttttgtgacagcaaca
aaaggtaatttacccgttagaattaaagatattagtgataaaggtattgcgcaggcactt
aactatagttggaaagcgttatcaactaaggtcaagaaaaaacggctctctgctcgtgaa
cgccaaagacaaatggggttattatcagggacattggattatagcggtttccatcaaact
aaccttattgtcgaagctgtttttgaagatttggctttaaagcaaaaaatggtggctgat
attgaagccttaggtgaaggcaagatcatctttgcttcaaatacgtcttctcttcctatc
cataaaattgctgaaaaagcacaatatccagaaaaaataattgggctgcactattttagt
cccgttgaaaaaatgcccttagttgaagtgatccctcatgaaaaaacggatgctaagaca
atcgccacaaccgttgcttttgctaaaaaacaaggcaaagttgccattgtggtaggagat
aaacccggtttttatgtcaatcgaattctcgccccttatattagtgaagccttaacctgt
ttggttgaaggggaaacgatagagaatattgacaaggcattagttcaatttggctttcca
gtcggccccattcaacttttagatgaagtgggaattgatattggtactaaaataacgcct
attttagtcaatgagtttggtgagcgttttgcatctcctcctgcggttgatgcgattatt
gcggatgacagaaaagggcgtaaaaacggtcgtggtttttatctctataatcagcatgcc
ttacctttctctttaggaaaaaataaaaagcgtgcagatccgatgatttatcgcttatta
caggttaaacctaaaaatcagttatcggcttcagaaataaccgaacgttgtttattgctt
atgcttaatgaagctgttcgttgtttagatgaaaacattattcaacaacctagggatggt
gatattggtgctgttttcggtattggttttcctcccttctttggtggaccattccggtat
atagatagtatgggaacaacaaaaatagtcgataagcttaatcaattaactgaaaaatac
ggtgaaaagttccagccatgtgagcgattagcagcaatggccgagttaaatgaacgattc
tatagctaa

DBGET integrated database retrieval system