KEGG   Proteus mirabilis HI4320: PMI2462Help
Entry
PMI2462           CDS       T00753                                 

Definition
plasmid-related disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pmr  Proteus mirabilis HI4320
Brite
Enzymes [BR:pmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PMI2462
Secretion system [BR:pmr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PMI2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2691642..2692334)
Genome map
AA seq 230 aa AA seqDB search
MRKLSPIILALALSPLVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNGRIVFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMDDLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACNLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccaattattctggcgcttgcgctgtctcctttggttcaagctgaa
ccagtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttgcctgtcacg
ggtatgaaagcggttgaaagcaatggccgtattgttttcatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtcgaaaaagccgcttactagccttgaagaa
attcgagaagcgggaaacacgctggacttaagtcgtcttggtttaaaaatggatgatttg
aacccactgacgctgggcgaaggcaaaaagaaagtggtggtctttgttgatccacgatgc
ccgcactgccatgagcttttgaaacaagctttaccgctaaccaaagaatacaccttccaa
atactccctgtgccagtgcttggtcctgattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaaaaaagcggccaccgatgcattgctgaatggccggattggtaacctagaa
caggatgatgcctgcaacttagaaccaatgcagcgtaccttggtgacggctcaaatcctg
ggcattcaaggtgtgcctttcatcgtcgccaatgatggtcgcatcagccgaggccgtcct
tatgatctttctgcttggttggaggggcgttaa

DBGET integrated database retrieval system