KEGG   Proteus mirabilis HI4320: PMI2495Help
Entry
PMI2495           CDS       T00753                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMI2495 (holD)
   00240 Pyrimidine metabolism
    PMI2495 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PMI2495 (holD)
   03430 Mismatch repair
    PMI2495 (holD)
   03440 Homologous recombination
    PMI2495 (holD)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PMI2495 (holD)
DNA replication proteins [BR:pmr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PMI2495 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2733347..2733757)
Genome map
AA seq 136 aa AA seqDB search
MSRKDRMLAQLGIRQWVLRKPAVLKGEHSVQFPDTTRLLIITDDVVDLNNGLFSDIFSTM
GIDKSEIYCITSEDVSLLTGSFTPACWLLGTDITLPAQYTSLRSPSLHQLYFDANAKRDL
WKQIYQHEDHFPIKPC
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaaagacagaatgttagcccaacttggaattcgtcaatgggtacttcgtaag
cctgctgtattaaaaggcgaacattctgtgcaatttccggataccactcgtttacttatc
attactgatgatgttgttgatctaaataacgggcttttctctgatatttttagcactatg
ggaatagataaaagtgaaatctattgtattacctcagaggatgtgagcctgctcacagga
tcatttacaccagcctgttggctattaggtactgatatcactctacctgctcaatatact
tctctgagaagcccttcattacatcaattatattttgatgccaatgcaaaacgcgatctt
tggaaacaaatctatcaacatgaagaccatttccccattaaaccctgctga

DBGET integrated database retrieval system