KEGG   Proteus mirabilis HI4320: PMI2500Help
Entry
PMI2500           CDS       T00753                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase precursor
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PMI2500 (phoA)
   00790 Folate biosynthesis
    PMI2500 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PMI2500 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PMI2500 (phoA)
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PMI2500 (phoA)
Exosome [BR:pmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMI2500 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pmr00537]
 Enzymes
  PMI2500 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2738069..2739508)
Genome map
AA seq 479 aa AA seqDB search
MSLRYQRSALSVVVATLFTSVSFSSFAAPVTADTILAQDRAAKGNITEFGGARRITSDQT
EALKAALNNHQAKNVILFIGDGMGDSEITVARNYAEGAGGFFKGIDALPMTGQYTHYSLD
RKTQKPNYVTDSAASATAWASGVKTYNGALGIDVFGKDHQTILELAKANGKATGNVTTSE
IQDATPAALFSHVTGRKCYGPVETLAKCSTNALENGGRGSISEQLLVTRADITLGGGAKS
FAQTATAGEYKGKTLEQQAIERGYQIVKDAKSLEAITLANQDKPVLGLFHDGNMAVAWEG
PKATYQGNLKNPPLECKPNSKLDPNAPTLAQMTKKAIDLLKTNENGFFLQVESASIDKQD
HNANPCGQIGETVALDEAVQIGLDFAKQNGDTLIIVTADHAHSSQIIEADVKSSGLTQAL
ITKDGAVMVVNYGNSETDSQEHTGAQLRVAAYGPHAANVVGLTDQTDLFFTMRDAMGLK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctctacgttatcaacgttctgcgttatctgtagtcgtcgcaacactctttacaagc
gtgagtttctcttcttttgcagcccccgtcactgccgatactattttggcgcaagatcgc
gcagcaaaaggtaatattacggaatttggtggtgctcgtcgtataacctcagatcaaact
gaagcattaaaagcagcacttaataatcatcaagctaaaaatgtgatcctatttatcggt
gatgggatgggggattctgagataacggtagcacgtaactatgccgaaggggctggtggc
ttctttaaagggattgatgcgttaccgatgaccggccaatatactcattattctttagat
agaaaaacacaaaaacctaattatgtaacagattcggccgcatcagcaacagcatgggct
tcaggggttaaaacctataatggggcattagggattgatgtgtttggtaaagatcaccaa
acgattttggaattagcaaaagcgaatggtaaagcgacggggaatgtcactacctctgaa
attcaagatgcaacaccggctgcgctattttcacatgttaccgggcgtaagtgttatggg
cctgtagaaacgttagcaaaatgctcaacgaatgcgctagaaaatggcggtagaggttca
atctctgagcaattgttagtgactcgtgcagatattacactgggaggaggcgcgaaaagt
tttgctcaaacagcaacggccggtgaatataaagggaaaacgctcgagcaacaagcaata
gagcgtggctatcaaattgtgaaagatgctaaatcgttagaggcgattacgctagcaaat
caagataaacctgtgttaggtctatttcatgacggtaatatggccgtcgcttgggaaggg
ccaaaagccacttatcaaggtaatttaaagaatcctcctttagagtgtaaaccgaattca
aaattagacccgaatgcaccaacattagcgcaaatgaccaaaaaagcgattgatttgctg
aaaacgaatgaaaatggtttcttcttacaagtcgaaagcgcctccattgataaacaagat
cataatgctaatccttgtggtcaaattggtgaaacggtggcattagatgaagcggtacaa
attggtttagatttcgctaaacaaaatggtgatacgcttattatagtgaccgcagatcac
gctcactctagtcaaattattgaagctgatgtgaaatcaagcggcttaacacaagcattg
attaccaaagatggcgctgtcatggtggtgaattatggtaactcagaaacggattcacaa
gagcatacaggcgcgcaattacgcgttgccgcttatggtccacatgctgctaatgtcgta
gggttaacagaccaaacagatcttttctttactatgcgcgatgcgatgggattgaaataa

DBGET integrated database retrieval system