KEGG   Proteus mirabilis HI4320: PMI3037Help
Entry
PMI3037           CDS       T00753                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00010  Glycolysis / Gluconeogenesis
pmr00620  Pyruvate metabolism
pmr00640  Propanoate metabolism
pmr00680  Methane metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01130  Biosynthesis of antibiotics
pmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMI3037 (acs)
   00620 Pyruvate metabolism
    PMI3037 (acs)
   00640 Propanoate metabolism
    PMI3037 (acs)
  Energy metabolism
   00680 Methane metabolism
    PMI3037 (acs)
Enzymes [BR:pmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMI3037 (acs)
Lipid biosynthesis proteins [BR:pmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMI3037 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAR45975
UniProt: B4F0C1
Position
3332999..3334957
Genome map
AA seq 652 aa AA seqDB search
MTKINQHHIPANIAEHALINKEQYQKDYALSIENPEAFWADKGKIVDWITPYTIVKNTSF
DPGHVRIRWFEDGQLNISQNCLDRHLEKRADQVAIIWEGDSPNESKSITYRQLHQDVCQF
ANVLKKLGIKKGDVVAIYMPMVPEAAVAMLACTRIGAIHSVIFGGFSPEAVAGRIIDSKA
KLVITADEGLRAGRAIPLKKNVDDALTHVDIPPIEHVVVLRRTGQTEQWIEGRDLWWDEI
VQGVSTECDVEVMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTFKYTFDYHDGEI
YWCTADVGWVTGHSYLLYGPLSNGATTVMFEGVPNYPSVNRMAQIVDKHQVNILYTAPTA
IRALMAEGDKAIEGTQRTSLRILGSVGEPINPEAWEWFYQKMGRSQCPIVDTWWQTETGG
FMITPLPGAMDLKPGSATRPFFGVQPAIVDNMGEIQDGACEGNLVIVDSWPGQARTLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGDYWITGRVDDVLNISGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTAELYTEVRNWVRKEIGPIATPDILHWTD
ALPKTRSGKIMRRILRKIASGDTTNLGDTSTLADPGVVEKLLEEKQSLSLTI
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaataaaccaacatcacattcctgcaaacattgcagagcacgccctgattaat
aaagagcaataccaaaaagattatgcattatccatcgaaaaccctgaggccttttgggca
gataaagggaaaattgttgattggataaccccctatactattgtgaaaaatacctccttt
gatccaggccatgtccgtattcgctggtttgaagatgggcaacttaacattagccaaaac
tgtcttgatcgccatttagaaaaacgcgcggatcaagttgctattatttgggaaggtgat
tcccctaatgaatcgaaaagcattacctatcgccaacttcatcaagatgtttgtcaattc
gccaatgtattaaaaaaactgggtatcaaaaaaggcgatgtggtggctatttatatgcca
atggttcctgaagcggctgttgcgatgttggcttgtactcgtattggggctattcattct
gttatttttggtggtttctcaccagaagcagtggcagggcgcattattgactctaaagca
aaattagtgatcactgcagatgaaggcttacgtgctggtagagcaatccccttaaagaaa
aatgttgatgatgccctcactcatgtggatatcccgcctattgaacatgttgtggtctta
cgtcgaacagggcaaacagaacaatggattgaaggacgcgatttatggtgggatgaaatt
gttcaaggcgtcagtacagaatgtgatgtggaagtcatgaacgcagaagatccactcttt
attctctacacatcaggctctacggggaaacccaaaggcgtattgcacaccactggcggt
tatcttgtttatgcctcaatgacctttaaatacacctttgactatcatgatggtgagatt
tattggtgtacagcggatgtcggttgggtaactggccatagctacttgttatatggcccg
ctatcaaatggtgccacaacagtgatgtttgagggcgtccccaattacccctccgtcaat
cgtatggcccagattgttgataaacaccaagttaatattctctataccgcacctactgcg
atccgcgcattaatggcggaaggagacaaagccattgaaggtacacaacgaacctcttta
cgcattttaggctcagtaggagagcctattaacccagaagcttgggaatggttttatcaa
aaaatgggacgtagccaatgccctattgttgatacatggtggcaaacagaaacaggaggc
ttcatgataaccccattgccaggagcaatggatctaaaaccaggctcagcgactcgtcca
ttctttggtgtacaacctgcgattgttgacaatatgggggaaatacaagacggtgcttgt
gaaggtaatttggtgatcgtagattcatggccgggccaagcaagaacattatttggcgat
catgaccgttttgaacagacttacttttcaacctttaaaggcatgtacttttcaggtgat
ggtgcccgccgtgatgaggacggtgattattggataacaggccgtgttgatgatgtttta
aatatctctggtcaccgtttaggtactgctgaaattgaatcagcacttgtcgcccatcct
aaaattgcagaagcggctgttgttggtattccccataatataaaaggacaagctatttat
gcttatgtcacgctaaatcatggtgaagagcctacggcagagctttatacagaagtgcgc
aattgggtacgtaaagagataggcccaatagcaacacctgatatccttcattggacagat
gccttacctaaaacacgctctgggaaaattatgcgtcgtatcttgcgtaaaattgcctct
ggcgacacaactaaccttggagatacctcaacactcgccgatccaggcgttgtagaaaaa
ctgttagaagaaaaacagtctctatcactgaccatttaa

DBGET integrated database retrieval system