KEGG   Proteus mirabilis HI4320: PMI3103Help
Entry
PMI3103           CDS       T00753                                 

Gene name
celY
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3411101..3412138
Genome map
AA seq 345 aa AA seqDB search
MSIRQLSRLTHRLGILLTLSVMLMISPMTQATETQAGWQQFKARYITPEGRVIDSANQNI
SHSEGQGYGMLMAVMSDDRQTFAQLWHWTAMSLYRGDLGLFKWRYEPENNQHTPDPNNAT
DGDILIAWALLKAGEKWHDESYLSASDSIQHAILEHTLVKTENYSVLLPGINGFKTPEEI
IINPSYFIFPAWKDFYRVSHDSRWKNLINDSQSLLRKMRFGKYKLPSDWVSLYPDGHLAP
SEKWPARFSFDAIRIPLYLAWAQDKLALQPFVNYWQQFDRDKTPAWISIDGKERADYNLT
PGMMAVRDLTMKTVIENVDLTKDTDYYSSALHLLAAFAQNNHNDY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtccataagacagttatctcgattgactcatcgacttggtattttgctaacactaagt
gtgatgttaatgatatccccaatgacacaagcgacagaaacccaagcaggatggcaacaa
tttaaagcgcgttacattactcccgaggggcgtgtcattgacagtgctaatcaaaatatt
tcacactcagaaggtcaaggatatggcatgttaatggcggttatgagtgacgatcgccaa
acctttgcacaattatggcactggacggcaatgtcgctgtatcgtggtgatcttggctta
tttaaatggcgttatgaacccgaaaataaccaacatacacccgatcctaataatgcaaca
gatggtgatattttaattgcttgggcattattaaaggctggggaaaaatggcatgatgaa
agctatctttcagcgtcagattctattcagcatgcgatccttgaacacactttagtgaag
acagaaaactacagtgtactcttaccgggaattaatggctttaaaactcccgaagaaatt
attattaacccctcctattttatctttccggcatggaaagatttctatcgagttagtcat
gatagccgctggaaaaatttaattaacgatagccaatccttattaagaaaaatgcgtttt
ggtaaatataaattaccaagtgattgggtaagtttataccctgatggtcatcttgccccg
agtgaaaaatggccagcacgatttagttttgatgctattcgcattcctctttatttagca
tgggcacaagataaactcgcattacaaccttttgtgaattattggcaacaatttgatcgt
gataagacgcctgcgtggatcagtattgatggtaaagagcgcgctgattataacttaacg
ccaggtatgatggcggtaagagatctgacaatgaaaacagtaattgaaaatgttgattta
actaaggatacggattattactcttcagccttacatttattagccgcctttgcgcagaat
aatcacaatgactattaa

DBGET integrated database retrieval system