KEGG   Proteus mirabilis HI4320: PMI3203Help
Entry
PMI3203           CDS       T00753                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00010  Glycolysis / Gluconeogenesis
pmr00030  Pentose phosphate pathway
pmr00051  Fructose and mannose metabolism
pmr00052  Galactose metabolism
pmr00680  Methane metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01130  Biosynthesis of antibiotics
pmr01200  Carbon metabolism
pmr01230  Biosynthesis of amino acids
pmr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMI3203 (pfkA)
   00030 Pentose phosphate pathway
    PMI3203 (pfkA)
   00051 Fructose and mannose metabolism
    PMI3203 (pfkA)
   00052 Galactose metabolism
    PMI3203 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PMI3203 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PMI3203 (pfkA)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PMI3203 (pfkA)
Protein phosphatases and associated proteins [BR:pmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PMI3203 (pfkA)
Messenger RNA biogenesis [BR:pmr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PMI3203 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAR46281
UniProt: B4F159
Position
3517519..3518496
Genome map
AA seq 325 aa AA seqDB search
MVNGIKRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVYGIFDGYMGLYENRMKKLDRFS
VSDMINRGGTFLGSARFPEFREDNVRAVAIENMKQNELDALVVIGGDGSYLGAKKLTEAG
FPCIGLPGTIDNDVAGTDYTIGYFTALETAVEAIDRLRDTSTSHKRISIVEVMGRYCGDL
TLSAAIAGGCEFVVLPESELPFDRDELLAEIKAGIERGKRHAIVAITEHVCDVHELARFI
EAETKHETRATVLGHIQRGGSPVAYDRILASRMGAYSVQLLLEGYGGRCVGIQNEKLVHH
DIIDAVMNMKRVFKADWYETAKKLY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggttaatgggatcaaaagaattggggttttaacaagtggtggtgatgcaccgggtatg
aatgccgcgatccgtggtgttgtccgtgcagcactcagcgaaggtttagaagtgtacggt
atttttgatggctatatgggcttatatgaaaaccgtatgaaaaaactcgatcgctttagt
gtgtcagacatgatcaaccgtggtggtacttttttaggctctgcgcgtttcccagaattc
cgcgaagataatgtgcgtgccgttgctattgaaaatatgaagcaaaatgagctagatgca
ctggtggttatcgggggagatggttcttatctgggggcgaaaaaattaactgaagcgggt
ttcccatgtattggtttaccgggcaccattgataatgacgttgcgggtactgattacact
attggctatttcacggcgttagaaacggcggtagaagcgattgaccgcttacgtgatacc
tcaacatcccataaacgtatctctatcgttgaagtgatgggacgttattgtggtgattta
accttatccgctgctattgcgggtggttgtgagttcgtggtgttgcctgaatccgaatta
ccttttgatcgtgatgaattattagcagaaattaaagcgggtattgagcgtggtaaacgt
catgctatcgtggcaattactgaacatgtgtgtgatgtacatgagctggcacgttttatt
gaagcagaaaccaaacatgaaacacgtgccactgtattaggccatattcaacgtggcggc
tctccggttgcttacgatcgtattttagcctctcgtatgggtgcttactctgtacaactg
ctacttgaaggttatggtggtcgttgtgtagggatccaaaatgaaaaactggttcaccat
gatattattgatgcggttatgaatatgaaacgtgtctttaaagccgattggtatgaaact
gcgaaaaaactgtattaa

DBGET integrated database retrieval system