KEGG   Proteus mirabilis HI4320: PMI3203Help
Entry
PMI3203           CDS       T00753                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMI3203 (pfkA)
   01230 Biosynthesis of amino acids
    PMI3203 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMI3203 (pfkA)
   00030 Pentose phosphate pathway
    PMI3203 (pfkA)
   00051 Fructose and mannose metabolism
    PMI3203 (pfkA)
   00052 Galactose metabolism
    PMI3203 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PMI3203 (pfkA)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PMI3203 (pfkA)
Protein phosphatases and associated proteins [BR:pmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PMI3203 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3517519..3518496
Genome map
AA seq 325 aa AA seqDB search
MVNGIKRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVYGIFDGYMGLYENRMKKLDRFS
VSDMINRGGTFLGSARFPEFREDNVRAVAIENMKQNELDALVVIGGDGSYLGAKKLTEAG
FPCIGLPGTIDNDVAGTDYTIGYFTALETAVEAIDRLRDTSTSHKRISIVEVMGRYCGDL
TLSAAIAGGCEFVVLPESELPFDRDELLAEIKAGIERGKRHAIVAITEHVCDVHELARFI
EAETKHETRATVLGHIQRGGSPVAYDRILASRMGAYSVQLLLEGYGGRCVGIQNEKLVHH
DIIDAVMNMKRVFKADWYETAKKLY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggttaatgggatcaaaagaattggggttttaacaagtggtggtgatgcaccgggtatg
aatgccgcgatccgtggtgttgtccgtgcagcactcagcgaaggtttagaagtgtacggt
atttttgatggctatatgggcttatatgaaaaccgtatgaaaaaactcgatcgctttagt
gtgtcagacatgatcaaccgtggtggtacttttttaggctctgcgcgtttcccagaattc
cgcgaagataatgtgcgtgccgttgctattgaaaatatgaagcaaaatgagctagatgca
ctggtggttatcgggggagatggttcttatctgggggcgaaaaaattaactgaagcgggt
ttcccatgtattggtttaccgggcaccattgataatgacgttgcgggtactgattacact
attggctatttcacggcgttagaaacggcggtagaagcgattgaccgcttacgtgatacc
tcaacatcccataaacgtatctctatcgttgaagtgatgggacgttattgtggtgattta
accttatccgctgctattgcgggtggttgtgagttcgtggtgttgcctgaatccgaatta
ccttttgatcgtgatgaattattagcagaaattaaagcgggtattgagcgtggtaaacgt
catgctatcgtggcaattactgaacatgtgtgtgatgtacatgagctggcacgttttatt
gaagcagaaaccaaacatgaaacacgtgccactgtattaggccatattcaacgtggcggc
tctccggttgcttacgatcgtattttagcctctcgtatgggtgcttactctgtacaactg
ctacttgaaggttatggtggtcgttgtgtagggatccaaaatgaaaaactggttcaccat
gatattattgatgcggttatgaatatgaaacgtgtctttaaagccgattggtatgaaact
gcgaaaaaactgtattaa

DBGET integrated database retrieval system