KEGG   Proteus mirabilis HI4320: PMI3205Help
Entry
PMI3205           CDS       T00753                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMI3205 (tpiA)
   01230 Biosynthesis of amino acids
    PMI3205 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMI3205 (tpiA)
   00051 Fructose and mannose metabolism
    PMI3205 (tpiA)
   00562 Inositol phosphate metabolism
    PMI3205 (tpiA)
Enzymes [BR:pmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMI3205 (tpiA)
Exosome [BR:pmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMI3205 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMI3205 (tpiA)
  Exosomal proteins of melanoma cells
   PMI3205 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3519891..3520661)
Genome map
AA seq 256 aa AA seqDB search
MRHPLVMGNWKLNGSIHMVHELIAALRKEISGVAGCDVAIAPPTVYLCQARHEIGGSRIA
LGAQDTGVNLSGAFTGETSPEMLKNVDVKYVIIGHSERRTYHKESDEFIAQKFGVLKELG
LTPVLCIGETEAENEAGKTQEVCARQIDAILNAHGAQAFKDAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAIAEQVIIQYGGSVNDKNAAELFSQPDIDGALVGGASLKAD
AFAVIVKAAAEAKAKK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatccattagtcatgggtaactggaaacttaacggcagcattcatatggttcat
gaattaatcgctgcattacgtaaagaaatcagcggtgttgctggatgtgatgttgctatt
gcaccaccaacagtttatctgtgccaagctcgtcatgaaatcggtggaagccgtattgcg
ttaggtgcccaagataccggtgttaacttatctggtgctttcactggcgaaacttcccca
gaaatgctgaaaaacgttgatgttaaatacgtgatcatcggtcactctgaacgtcgtact
taccataaagaatctgatgaatttatcgcacaaaaatttggtgtgttaaaagagttaggc
ttaacacctgtgttatgtatcggtgaaacagaagcagaaaatgaagctggtaaaacacaa
gaagtgtgcgcacgtcaaatcgacgcgattttaaatgcacatggtgcacaagcattcaaa
gatgcagtgatcgcttatgaacctatttgggcgatcggtacaggtaaatcagcaacgcct
gcacaagcacaagcggtacataaatttattcgtgatcatatcgctaaacaagatgcggct
atcgctgagcaagtcattattcaatacggcggttcagtcaacgataaaaacgcagcagag
ctatttagccaacctgatatcgacggagcattggttggtggcgcgtcactgaaagcggat
gcctttgctgttatcgtgaaagcggcagcagaagcaaaagcgaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system