KEGG   Proteus mirabilis HI4320: PMI3331Help
Entry
PMI3331           CDS       T00753                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00860  Porphyrin and chlorophyll metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
Module
pmr_M00121  Heme biosynthesis, glutamate => heme
pmr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMI3331 (hemD)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PMI3331 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAR46537
UniProt: B4F1X2
Position
complement(3652517..3653254)
Genome map
AA seq 245 aa AA seqDB search
MSILITRPSPAGEQLTQRLIDAGKHAFHAPLIEIAAGKELSILENKLNKLSTGDYLFLLS
KNAVWYANWQLNQLQQSWPDTLFYYGIGQSTAEEFQQLTGHSIRYPEFGETSEDLLALSS
LQQIENKRVLLLRGNGGRELLATTLRQRGAIVDECECYQRLFIDYVSEEFALKWKNAQVD
TFVVTSGEMLQQLFYLVAGSEKAWLLNSHLVVVSKRLATIASTLGFKKITVAESANNDAL
FHALI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttaatcactcgtcctagcccagcaggagaacaacttacgcaacgcttaatt
gatgcgggaaagcatgcttttcatgcacctttaatagaaatagccgcgggtaaagagctt
tccatattagaaaacaaattaaataagctaagtacgggtgattacctttttttactttct
aaaaatgcggtgtggtacgcaaactggcaactaaatcaattacaacaatcatggccagat
acgctattctattatggaataggtcaaagcaccgctgaagagtttcagcaattaacagga
cattctatacgttatccagaatttggagaaaccagtgaagacctactggccttgtcttca
cttcaacaaatagaaaacaagcgagtactactactaagaggcaatggtggtcgcgaacta
cttgccacaacattacgtcaacgcggtgcaattgttgatgaatgtgaatgttatcagcgt
ctatttattgattatgtatctgaagagtttgcgctaaagtggaaaaatgcccaagtggat
acctttgtggtcaccagtggcgaaatgttgcaacaactcttttatctagtcgctggatct
gaaaaagcatggctgttaaacagtcatttagtggtggtcagtaaacgattagcaacaata
gctagcacattaggctttaaaaaaataaccgttgctgaaagtgccaataatgatgcttta
tttcatgcattaatatag

DBGET integrated database retrieval system