KEGG   Proteus mirabilis HI4320: PMI3344Help
Entry
PMI3344           CDS       T00753                                 

Gene name
pldA
Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PMI3344 (pldA)
   00565 Ether lipid metabolism
    PMI3344 (pldA)
   00590 Arachidonic acid metabolism
    PMI3344 (pldA)
   00591 Linoleic acid metabolism
    PMI3344 (pldA)
   00592 alpha-Linolenic acid metabolism
    PMI3344 (pldA)
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PMI3344 (pldA)
    3.1.1.32  phospholipase A1
     PMI3344 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3666252..3667127
Genome map
AA seq 291 aa AA seqDB search
MRYIRSLLTVILTYPVWGVAAEISPVSSPTPLVQGSIISGLLQEYDSPFVLYPYESNYII
YTKTSDMNKEAIASYDWGHKAKKDEVKFQISLAFPLWRGIAGENSVLAASYTQRSWWQLS
NKKESAPFRETNYEPQLFLGWATDYQFAGWTLREIETGFNHESNGRAEPTSRSWNRVYAR
FMAQKGNFQLDLKPWYRFNESAKNDDNPDINRYMGYYRLKAGYRLGESTFTLTGRYNWSS
GYGAAELGWSYPITKHVRFYTQLFSGYGESMIDYNFRQTRIGVGVMLNDML
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatccgttctttactcacggtgattttaacctaccctgtatggggagtggcg
gcggagatatcacctgtatcatctccaacaccgttggttcagggcagtattatttccggt
ctattacaagagtatgattcaccctttgtactttacccttatgaatctaattatattatt
tacacaaaaacctccgatatgaataaagaggcgattgccagttatgattggggtcataag
gctaaaaaagatgaagttaaatttcagataagtcttgcattcccgctgtggcgtggcatt
gccggggaaaattctgtattagcggcttcctatacgcaacgctcttggtggcagctaagt
aataaaaaagagtctgcgccgtttcgcgaaaccaactatgaaccacaactatttttaggt
tgggcgacggattatcaatttgccggttggacattaagagaaattgaaacgggatttaac
catgaatcgaatggccgcgcagagcctacttcacgaagttggaatcgtgtttatgcacgt
tttatggcgcaaaaaggtaatttccaactcgatctgaaaccttggtaccgttttaatgaa
agtgctaaaaatgatgataatcccgatattaatcgctatatgggatattaccgcttaaaa
gcgggttatcgtttaggcgaaagtacgtttactttaacagggcgttataactggagtagc
ggatacggtgctgctgagctaggctggagctatcctattaccaagcatgtacgcttttat
acccaactatttagtgggtatggggagtcgatgattgattataatttccgtcaaactcgt
atcggtgtcggcgttatgctcaatgatatgctgtaa

DBGET integrated database retrieval system