KEGG   Proteus mirabilis HI4320: PMI3346Help
Entry
PMI3346           CDS       T00753                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PMI3346 (pldB)
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PMI3346 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3669089..3670093
Genome map
AA seq 334 aa AA seqDB search
MTTTLFQHMWLSREKQFSAFTNGILLDFWNQRQEGEFTGVDGVSIRYAHWRSSSHKKALV
ICSGRSESYVKYPEVAFDFYHLGYDIFLLDHRGQGLSGRLLDDPQKGHVEKFSDYVDDLS
TFIDTIVLPYHYQHYFALAHSMGGAILASYLLRKPDIFQAAALCAPMFGINLPIPRWVAN
FLVNRAEQSVSERNNYAVSTGKWFPLPFILNVLTHSHERYRRYLRYYADFPQLRLGGPTY
HWMKESLETGDWLIEHAKEINTPLLVLEAELDKVVDNRGVRAFCDGYSQSRTREEKQKLP
LVIEGAHHEILFEIDKLRSQALIEICEFYDKHLF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacactttttcagcacatgtggttatctcgtgaaaagcaattctctgctttt
acgaatggtatcttattggacttttggaaccaacgacaggaaggcgaatttaccggagtc
gatggcgtgagcattcgctatgctcattggcgctcttcatcacacaaaaaagcgttggtg
atctgctctggtcgtagtgaaagttatgtaaaatatcctgaagtggccttcgatttttat
catcttggttatgatatttttcttctcgatcatcgggggcaaggattatcagggcgctta
ttagatgatccgcaaaaaggccacgtagaaaaattcagtgattatgtcgatgatttatcg
acatttattgatactatcgttttgccttatcactatcagcactattttgcgttagcccat
tcgatgggcggcgctattttagccagctacctattacgtaaacctgatattttccaagcc
gccgcactgtgtgcgccgatgtttgggattaatttaccaataccacgctgggtggctaat
tttttagttaaccgtgcagaacaaagtgtttcagaacgaaataattacgcggtatcaacg
ggcaaatggtttcctttgccatttatcttgaatgtattgactcatagccatgaaaggtat
cgtcgatacttacgttactatgccgatttccctcaattacgtttaggtgggccgacctat
cattggatgaaagagagcctagaaacgggggattggctgattgaacatgcaaaagagatt
aacacccctttgctagtacttgaagctgagctagataaagtggtggataatcggggagta
agggctttctgtgatggttatagtcagtccagaacaagagaagaaaagcaaaaattgcca
cttgtgattgaaggtgcgcaccatgaaatcttgttcgaaatagataagctacgctcacaa
gcattaattgaaatctgtgagttttatgataagcatttattttaa

DBGET integrated database retrieval system