KEGG   Proteus mirabilis HI4320: PMI3513Help
Entry
PMI3513           CDS       T00753                                 

Gene name
deoK
Definition
deoxyribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMI3513 (deoK)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PMI3513 (deoK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3833162..3834082
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYIDRMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVMMLTKV
GDDIFADNTIMNLESYGINTRYVEKVPGTTSGVAPIFVTSQSSNSILIVKGANQHLSAED
IDRAAVSLKKCRMIVLQLEIPLETVYHAIEFGNKHHIPVLFNPAPASKALDLTIAAQCDF
FVPNETELEILTGMPINTLDEIREAAYFLLEKGFKNIIVTLGEKGALWVNGEIEKYIPAI
EVNAVDTSGAGDAFIGCFSHYYVHTGNIEEALNKAVMFSGLSVTGKGTQSSYPSIEEFSE
FLSSAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcagtgattggttcaaatatggtggatttgatcacctatatagataggatg
ccaaaagagggagaaacccttgaggcgccagcatttaagattggttgcggcgggaaaggg
gcaaatcaagcggttgccgctgcaaaattaaattctaaggtgatgatgttaaccaaagtg
ggagatgatattttcgcagataacaccatcatgaatttagagtcttatggtattaatact
cgttatgttgaaaaagtgcccggaaccaccagcggtgttgcacctatttttgttacctct
caatcatccaatagtattttgatcgtaaaaggcgcgaatcagcatctatctgctgaagat
atcgatagagccgcggtgagtttaaaaaaatgtcgtatgattgtgctgcaattagaaatc
ccgcttgaaacggtctatcacgcgattgagttcggtaataaacatcatattccagtattg
tttaaccctgcaccagcatcgaaagctttagatctcactatcgccgcacaatgtgatttt
tttgtccccaatgagacagagctggaaattttaacgggtatgccaattaatacgttggat
gaaattcgagaagcagcctactttttactcgaaaaagggtttaaaaatatcattgttaca
ttaggtgaaaaaggggcgttatgggtgaatggggaaattgagaaatatatccccgccatt
gaagttaatgccgttgataccagcggtgctggagatgcttttattggctgtttttctcat
tactatgtgcataccggcaatattgaagaagcgttaaataaagcggttatgttttcgggt
ttaagtgtcacaggaaaaggcactcaatcttcttatcctagtattgaagaatttagcgaa
tttttaagctcagcaaaatag

DBGET integrated database retrieval system