KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00071Help
Entry
KNP414_00071      CDS       T01550                                 

Gene name
murA1
Definition
protein MurA1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_00071 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KNP414_00071 (murA1)
Enzymes [BR:pms01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KNP414_00071 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66370..67794
Genome map
AA seq 474 aa AA seqDB search
MDSTTDINLSGLTNGIVTGGYKHIIQNTRRGTMMSKIIVRGGKKLSGRVRIHGAKNAVLP
IIAASILGSEGVSVIHDAPPLDDVLVINKVLESLGIAVEYRNETIRVDAGRITTCEASYD
LVRKMRASFLVMGPLLTRMGQARISLPGGCAIGTRPIDQHLKGFEAMGAEIELGQGYIEA
RVNGRLKGAKIYLDVASVGATENIMMAAALAEGTTLIENAAKEPEIVDLANYLNAMGAKI
RGAGTGLIRIDGVERLQGAVHTVIPDRIEAGTYMIAAAITGSDLYVEGAIGDHLRPVISK
MQEMGVQIEEDENGIRVYTVGPLKAVDVKTLPYPGFPTDMQSQMMALLLTAEGTSIVTET
VFENRFMHVEQMANMSAQIKVEGRTAVISGGARLQGAKVCATDLRAGAALILAALVAEGD
TEITGLHHIDRGYVGITEKLSLLGAEIRRLPLEIVEETEREEVLPLFAVQPSLA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatagtacaaccgatataaatctaagcggcctcacgaatggtatagtgaccggcggc
tacaagcacatcatacagaatacgcggagggggaccatgatgagcaaaattatcgtccgc
ggcggcaaaaagctttccggcagagtgagaattcacggtgccaaaaatgccgtactgccg
atcatcgcagcctctatcttgggatccgaaggagtcagtgtcattcatgacgcgcctccc
ttggacgacgtactggtcatcaataaagtacttgaaagcttaggcattgccgtggaatac
cggaacgaaacgatccgggtcgatgccggacgcatcaccacctgcgaggcatcctacgac
cttgtccgcaaaatgcgggcgtccttccttgtcatgggacctttattgacccggatgggt
caggcaagaatttccctgccgggcggctgtgccatcgggacaaggccgatcgatcagcac
ctgaagggctttgaggccatgggggcggagatcgaactgggccagggctacattgaagcc
cgggtcaacggccggctcaagggcgcgaagatttatcttgatgtcgcaagcgtcggcgcg
accgagaacatcatgatggcggccgctctcgcagaaggcacgaccctcatcgagaacgcc
gccaaggaaccggagattgtggaccttgcgaattacctgaacgctatgggcgcgaagatc
cgcggagcgggcacgggcctcatccggattgacggcgtggaacggcttcagggggcggtg
cacaccgtcattccggaccggatcgaagcgggtacatacatgattgccgcggcgattacc
ggcagcgacctctacgtagagggcgcgattggggatcacctgcggccggtcatctccaag
atgcaggagatgggcgtgcagatcgaagaagacgagaacggcatccgggtctacaccgta
ggtccgctgaaggccgtagacgtcaagacgctgccgtatccgggcttcccgaccgatatg
cagtcgcagatgatggcgctgctgctgaccgccgaaggcacctccattgtgacggagacg
gtattcgagaaccgcttcatgcatgtggagcagatggcgaacatgagcgcgcagatcaaa
gtcgaaggacggacggccgtcatcagcggcggtgccagactccagggcgccaaggtgtgc
gcaacggaccttcgggccggtgcagcccttattcttgccgcgctggtagcggaaggcgac
acggagatcacggggctgcatcatatcgaccgtggttacgtgggcatcaccgagaaactg
agcctgcttggcgccgagatccgccggctgccgctcgagatcgtcgaggagacggagcgg
gaagaagtgctgccgctgttcgcggtgcagccgagcctggcgtaa

DBGET integrated database retrieval system