KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00219Help
Entry
KNP414_00219      CDS       T01550                                 

Gene name
tpiA
Definition
(RefSeq) TpiA protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KNP414_00219 (tpiA)
   01230 Biosynthesis of amino acids
    KNP414_00219 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_00219 (tpiA)
   00051 Fructose and mannose metabolism
    KNP414_00219 (tpiA)
   00562 Inositol phosphate metabolism
    KNP414_00219 (tpiA)
Enzymes [BR:pms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KNP414_00219 (tpiA)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KNP414_00219 (tpiA)
  Exosomal proteins of bladder cancer cells
   KNP414_00219 (tpiA)
  Exosomal proteins of melanoma cells
   KNP414_00219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223973..224725
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFTNLPALVEAVKGTTLKV
GAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFGETDEIVNKKVQAAFKHGL
TPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQVVIAYEPIWAIGTGKSSTAA
DAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNIAEYMQQPDIDGALVGGASLEPA
SYIALIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggcaactggaaaatgttcaaaaccgtacaggaagccgtt
tctttcgtgaacgaagtaaaaggcaaagcggaagtggaaggcgtggagagcgtcatctgc
tccccgttcacgaatcttcctgccctggtggaagcggtgaaaggcacgacgctcaaagtc
ggcgcccagaatctccacttcgaagacaacggtgcttacacgggtgagatcagcggcgtt
atgctgaaggatctcggcgtagagtacgtcatcatcggtcactccgagcgccgggcttac
tttggcgagacggacgagatcgtgaacaagaaggtccaagcggcattcaaacacggtctg
actccgatcgtctgcgtaggcgagaagctcgaagagcgcgaagcgaaccagaccaaggac
gtatgcaaagtgcagaccgaaggcgcatttgcaggcctgagcgcagaacaggcggcacag
gtggtcatcgcctatgagccgatctgggctatcggaacaggcaagtcttctacagctgca
gacgctcaagacgtgatcggctacatccgtgaagtcgtaagcggcctgtatggcgctgag
acggctgcagcggtacgcatccagtacggcggcagcgtgaagccgaacaatattgcggaa
tacatgcagcagccggatatcgacggcgcgcttgtaggcggagcttccctggagccggcg
tcctacatcgccctgatcgagggggccaagtaa

DBGET integrated database retrieval system