KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00219Help
Entry
KNP414_00219      CDS       T01550                                 

Gene name
tpiA
Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00051  Fructose and mannose metabolism
pms00562  Inositol phosphate metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
pms01230  Biosynthesis of amino acids
Module
pms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pms_M00002  Glycolysis, core module involving three-carbon compounds
pms_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_00219 (tpiA)
   00051 Fructose and mannose metabolism
    KNP414_00219 (tpiA)
   00562 Inositol phosphate metabolism
    KNP414_00219 (tpiA)
Enzymes [BR:pms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KNP414_00219 (tpiA)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KNP414_00219 (tpiA)
  Exosomal proteins of bladder cancer cells
   KNP414_00219 (tpiA)
  Exosomal proteins of melanoma cells
   KNP414_00219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI38861
UniProt: F8FL01
Position
223973..224725
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFTNLPALVEAVKGTTLKV
GAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFGETDEIVNKKVQAAFKHGL
TPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQVVIAYEPIWAIGTGKSSTAA
DAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNIAEYMQQPDIDGALVGGASLEPA
SYIALIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggcaactggaaaatgttcaaaaccgtacaggaagccgtt
tctttcgtgaacgaagtaaaaggcaaagcggaagtggaaggcgtggagagcgtcatctgc
tccccgttcacgaatcttcctgccctggtggaagcggtgaaaggcacgacgctcaaagtc
ggcgcccagaatctccacttcgaagacaacggtgcttacacgggtgagatcagcggcgtt
atgctgaaggatctcggcgtagagtacgtcatcatcggtcactccgagcgccgggcttac
tttggcgagacggacgagatcgtgaacaagaaggtccaagcggcattcaaacacggtctg
actccgatcgtctgcgtaggcgagaagctcgaagagcgcgaagcgaaccagaccaaggac
gtatgcaaagtgcagaccgaaggcgcatttgcaggcctgagcgcagaacaggcggcacag
gtggtcatcgcctatgagccgatctgggctatcggaacaggcaagtcttctacagctgca
gacgctcaagacgtgatcggctacatccgtgaagtcgtaagcggcctgtatggcgctgag
acggctgcagcggtacgcatccagtacggcggcagcgtgaagccgaacaatattgcggaa
tacatgcagcagccggatatcgacggcgcgcttgtaggcggagcttccctggagccggcg
tcctacatcgccctgatcgagggggccaagtaa

DBGET integrated database retrieval system