KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00224Help
Entry
KNP414_00224      CDS       T01550                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Brite
Enzymes [BR:pms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     KNP414_00224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229140..229943
Genome map
AA seq 267 aa AA seqDB search
MTRQYRTTEPFHLEGTGERASTELLLIHGFTGSPSEFRRLGYYLNDLGYTVRGILLPGHG
TTPEDMIRTGLNDWSRHVTESFDTIRAQGGPDRRIVAVGHSMGGLLALKLAMERPLAGVV
SLAAPIFLASRKTVLAVLLQYFVKYVERRPTVPPHIIEEACSYSRTPIPCVVDLRKLLKH
VKTSLNEVKAPLFIGQGGRDKLVLPRSAEYIYRHVSSAFRQMAHYPSTSHAILLDEERER
VYADIHRFLVTLEHIGTWEQTAAGYAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcggcagtatcgaacaacggagccctttcacctggagggaacgggagagcgggca
tccacggaactcctgcttatccacgggtttaccggttcgccttcggagttccgccgcctg
ggctactacttgaacgatctgggctataccgtaagggggatcctgctgccgggccacgga
acgacgcccgaggatatgatccgtacggggctgaacgactggtccaggcatgtgacggag
agcttcgacaccatccgggcgcagggcggtccggatcggcggatcgtagccgtaggacat
tcgatgggcggtctcctggccttgaagctggcgatggagcgtccgctggccggggtcgtc
tccctcgccgcaccgatcttcctggcctcgcgcaagaccgtactggccgtgctgctgcag
tattttgtgaagtatgtggagcggcgtccgaccgtcccccctcatatcatcgaggaagcc
tgctcctacagccgtacgccgattccttgtgtcgtggatttgcgcaagctgcttaagcac
gtcaaaaccagtttaaatgaagtaaaggccccgctttttatcggacaagggggaagggac
aagcttgtgctgccgcgcagtgcggagtacatctaccgccatgtctcctcggctttccgg
cagatggcccattacccctccacctcgcatgccatcctgctggatgaggagcgggagcgg
gtatacgcggatattcaccgatttctggtgacgcttgagcatatagggacatgggaacaa
acggcggcggggtatgcgccataa

DBGET integrated database retrieval system