KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00353Help
Entry
KNP414_00353      CDS       T01550                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KNP414_00353
   01230 Biosynthesis of amino acids
    KNP414_00353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_00353
  Energy metabolism
   00680 Methane metabolism
    KNP414_00353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_00353
Enzymes [BR:pms01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KNP414_00353
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KNP414_00353
  Exosomal proteins of melanoma cells
   KNP414_00353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(351362..351964)
Genome map
AA seq 200 aa AA seqDB search
MTGVITTVYFVRHADSPYSAERERERGLSAAGEEAARRAALLLEDEGIGFLVSSPYRRAV
LTLQPLADRLGLPVAEEEDLRERKLSAEPLFPSREAFFEAKRSLFADPQLRYPGGESSEE
ARQRGTAVLRGLLLRHRGSRLALGTHGDIMTLMLGAWDPAYGFRFWQSTSMPDIYKAEFM
EDAAGPCLYAVTRLWRGPGA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggtcatcaccaccgtttatttcgtacgtcatgccgattccccctactccgcc
gagcgggagcgcgagcgcggattgtctgcggccggagaagaggccgcccggagagccgcc
ctgcttcttgaagacgaagggatcggcttcctcgtctcgagcccctatcggcgggctgtc
ctgacgctccagccgctggccgaccgtctcggactgcccgtcgcggaggaggaggatctc
cgggagcgcaagctgtccgcggagcctctgttcccatcgcgggaagccttcttcgaagcg
aagcgctccctcttcgcggacccgcagctccggtaccccggcggcgagtcaagcgaagaa
gcccggcagcgggggacagccgtcctccgcggtctgctgctccgtcaccggggcagcagg
cttgccctcggtacgcacggcgacatcatgaccttgatgctcggagcctgggaccccgct
tacggcttccgcttctggcagagcacgtccatgccggatatttataaagcggagttcatg
gaggatgccgcaggtccgtgcctgtacgccgttacccgcctgtggcggggaccaggagcc
taa

DBGET integrated database retrieval system