KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00353Help
Entry
KNP414_00353      CDS       T01550                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KNP414_00353
   01230 Biosynthesis of amino acids
    KNP414_00353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_00353
  Energy metabolism
   00680 Methane metabolism
    KNP414_00353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_00353
Enzymes [BR:pms01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KNP414_00353
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KNP414_00353
  Exosomal proteins of melanoma cells
   KNP414_00353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(351362..351964)
Genome map
AA seq 200 aa AA seqDB search
MTGVITTVYFVRHADSPYSAERERERGLSAAGEEAARRAALLLEDEGIGFLVSSPYRRAV
LTLQPLADRLGLPVAEEEDLRERKLSAEPLFPSREAFFEAKRSLFADPQLRYPGGESSEE
ARQRGTAVLRGLLLRHRGSRLALGTHGDIMTLMLGAWDPAYGFRFWQSTSMPDIYKAEFM
EDAAGPCLYAVTRLWRGPGA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggtcatcaccaccgtttatttcgtacgtcatgccgattccccctactccgcc
gagcgggagcgcgagcgcggattgtctgcggccggagaagaggccgcccggagagccgcc
ctgcttcttgaagacgaagggatcggcttcctcgtctcgagcccctatcggcgggctgtc
ctgacgctccagccgctggccgaccgtctcggactgcccgtcgcggaggaggaggatctc
cgggagcgcaagctgtccgcggagcctctgttcccatcgcgggaagccttcttcgaagcg
aagcgctccctcttcgcggacccgcagctccggtaccccggcggcgagtcaagcgaagaa
gcccggcagcgggggacagccgtcctccgcggtctgctgctccgtcaccggggcagcagg
cttgccctcggtacgcacggcgacatcatgaccttgatgctcggagcctgggaccccgct
tacggcttccgcttctggcagagcacgtccatgccggatatttataaagcggagttcatg
gaggatgccgcaggtccgtgcctgtacgccgttacccgcctgtggcggggaccaggagcc
taa

DBGET integrated database retrieval system