KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00355Help
Entry
KNP414_00355      CDS       T01550                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pms00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pms00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353276..354580
Genome map
AA seq 434 aa AA seqDB search
MKKAARWLCLLLGLAAAAGIEGCGSQSPVPPAGQQPPQSLQPERSGNEAAQEPVEPAMKP
RDDIRDRVEAMSLDEKVGQLLLVGLEGTEVDGRAREWIHTYHAGGFILFRDNIQNTAQLA
KLVGDLKEANRSSGGVPLWLSLDEEGGRVSRMPAELTKPPSAAAVGRADKPAASLAVGRA
VGRELAAFGMNMNFAPVLDVFSNPANTVIGDRAYGRDPAQVSRIGIQTMKGLQSQQVAAV
VKHFPGHGDTVEDSHYGLPVVAHDLERLRKLELKPFAEAITSGADAVMVAHILLPKLDAE
APASLSRRIVTGLLREEMGFGGVVVTDDLVMGAITKRYDLGQAGVQAVAAGVDVLLVGHG
HEAGTAVFSAVKRAVQEGVITEARLKESVTRILRLKAKYRLTDERPGAVDTAALNAGLKN
AMKELEVTAPAEGK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagcgagatggctgtgcctgctgctgggtctggcggccgctgcagggata
gaggggtgcggttcccaatcaccggtgcctccggccgggcagcagcccccccagtccctg
cagccggagcggtccggtaatgaggctgcacaggagcccgttgaaccggcgatgaagccg
cgtgatgacatccgggaccgggtggaggccatgtccctggatgagaaagtaggccagctg
ctgctggtcgggttggaaggcaccgaagtggacgggcgtgcgcgggagtggatacatacg
tatcatgcaggaggcttcatcctgttccgggataacattcagaatacggcccagctggcg
aagctggtcggagatctgaaggaagcgaaccgcagctccgggggcgtgccgctgtggctg
agcctggatgaggagggcggccgggtcagccggatgccggcggagctcaccaagccgcct
tccgccgcggcggtcggccgggcggacaagcctgccgcctcgctggcggtcggccgcgcc
gtcggccgggagcttgccgccttcgggatgaacatgaattttgccccggtgctggatgtg
ttcagcaatccggccaatacggtgatcggggaccgggcctacggccgcgacccggcacag
gtcagccgcataggcatccagacgatgaaggggctgcagtcccagcaggtggcggcggtg
gtgaagcacttcccgggccatggagatacggtggaggattcgcactacgggctgcccgtg
gtcgcgcatgatctggagcggctgcggaagctggagctgaagccgttcgccgaagcgata
acaagcggggccgatgccgtcatggtcgctcatattctcctgccgaagctggatgcggaa
gcgccggcctcgctctcccgccggatcgtgacgggccttctcagggaggagatgggcttc
ggcggcgtcgtggtaaccgacgacctcgtgatgggcgccattaccaagcgctacgatctc
gggcaggcgggtgtgcaggcggtggcggcaggtgtagatgtgctgctcgtcgggcatgga
cacgaggccggcacggccgtgttctccgccgtgaagcgcgccgtgcaggagggggtcatt
acggaagcaaggctgaaggagagcgtcacccggatcctgcggctgaaggcgaagtaccgg
ctcaccgacgaacgtccgggggctgtggacaccgccgccctgaacgccgggctgaagaac
gcgatgaaagagctggaagtaacggccccggccgaagggaagtag

DBGET integrated database retrieval system