KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00541Help
Entry
KNP414_00541      CDS       T01550                                 

Gene name
folE
Definition
protein FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pms00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563833..564423
Genome map
AA seq 196 aa AA seqDB search
MPAKEYRNNRVIENREQIEHHVREILRLIGEDVDREGLHDTPARVTRMYEEIFAGYEADV
KDILGVAFDEKHEELVIVKDIVYYSQCEHHMAPFFGRIHIGYIPSGKIAGLSKFARLVEA
VTRRLQVQERITSELADIIEGELEPHGCMVVVEGEHLCMCARGVKKPGSKTISSAVRGVF
RTDASSRAEFLSLIKD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaagaatacagaaataaccgcgtgatcgagaaccgcgaacagatcgagcac
catgtccgcgagattcttcggttgatcggtgaagatgtggaccgtgaaggtctgcatgac
accccggcacgcgtaacacgcatgtatgaagagattttcgcaggctatgaagccgatgtc
aaagacatcctcggcgtggcattcgacgagaagcacgaagagctggtcattgtcaaagat
atcgtctactacagccagtgcgagcaccatatggcgcctttcttcgggcggatccatatc
ggatatatcccgagcgggaagatcgcgggactgagcaaattcgcgcgtctggtggaggcc
gtcacccgccgcctccaggtgcaggaacgcattacctcggagctcgccgacatcatcgaa
ggggagctggagccccacggctgcatggtcgtggtggaaggcgagcatctgtgcatgtgc
gcccgcggcgtcaagaagccgggcagcaagacgatctcctcggctgtgcgcggcgtattc
cgtacggatgcgtcctcccgtgccgagttcctgtccctgatcaaggactag

DBGET integrated database retrieval system