KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00541Help
Entry
KNP414_00541      CDS       T01550                                 

Gene name
folE
Definition
protein FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KNP414_00541 (folE)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KNP414_00541 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563833..564423
Genome map
AA seq 196 aa AA seqDB search
MPAKEYRNNRVIENREQIEHHVREILRLIGEDVDREGLHDTPARVTRMYEEIFAGYEADV
KDILGVAFDEKHEELVIVKDIVYYSQCEHHMAPFFGRIHIGYIPSGKIAGLSKFARLVEA
VTRRLQVQERITSELADIIEGELEPHGCMVVVEGEHLCMCARGVKKPGSKTISSAVRGVF
RTDASSRAEFLSLIKD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaagaatacagaaataaccgcgtgatcgagaaccgcgaacagatcgagcac
catgtccgcgagattcttcggttgatcggtgaagatgtggaccgtgaaggtctgcatgac
accccggcacgcgtaacacgcatgtatgaagagattttcgcaggctatgaagccgatgtc
aaagacatcctcggcgtggcattcgacgagaagcacgaagagctggtcattgtcaaagat
atcgtctactacagccagtgcgagcaccatatggcgcctttcttcgggcggatccatatc
ggatatatcccgagcgggaagatcgcgggactgagcaaattcgcgcgtctggtggaggcc
gtcacccgccgcctccaggtgcaggaacgcattacctcggagctcgccgacatcatcgaa
ggggagctggagccccacggctgcatggtcgtggtggaaggcgagcatctgtgcatgtgc
gcccgcggcgtcaagaagccgggcagcaagacgatctcctcggctgtgcgcggcgtattc
cgtacggatgcgtcctcccgtgccgagttcctgtccctgatcaaggactag

  All links  
No link information was found.   
DBGET integrated database retrieval system