KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00835Help
Entry
KNP414_00835      CDS       T01550                                 

Gene name
phoD
Definition
PhoD protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pms00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pms00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pms02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852873..854510
Genome map
AA seq 545 aa AA seqDB search
MEQDKLGLLQQMMEKLGASSMDRRGFLRATGKVAAVSFGLTLASALQSPPKIGAEAFFKS
YPFTLGIASGDPLPDGVVLWTRLAPDPLNGGGMPSHDVPVRWEVALDKEFRRIVKHGVEF
ARTALAHSVHVEVEGLEPNQVYYYRFHAGHVESPVGRTKTLPPYGSAVAGMTFAFASCQN
WQDGYYTAYKHMSKENLDLVFHLGDYIYEGGVGTDKVRYHNSPEIVTLEDYRNRYALYKS
DADLRAAHEAFPWVVTTDDHEVENNYAGPIPEKDQPVEPFVQRRAAAYQAYYEHMPLRRS
SLPYGTEMQLYRRVTYGNLAEFSVLDTRQYRDDQANGDGSKEPNEASMDPNRTLMGAAQE
RWLLEGLGASAARWNVIPQQVFFAKRDFKQGDAELVSMDAWDGYSANRDRIVNFIKERGV
RNVVVLTGDVHANYANEIKADYHDPASPVIGVEFVGTSISSGGDGADTAANTATILAENP
HIRFHNTQRGYVRCTLTPDRFQADYLVLPYVSRPDAPIETRVSFEVEDGRPGLKKIYDSA
LVVTG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggacaagcttggcctgctgcagcagatgatggagaagctcggggcttcctcc
atggaccggagggggttcctccgcgcaaccggcaaggtggcagcggtttcattcggactt
acgctggcgagtgcgctgcagtcaccgccgaagatcggtgcggaggcgttcttcaagagc
tatccttttaccctcgggattgcttcgggtgacccgcttccggacggcgtagtcttgtgg
acccggctcgcacccgaccctctgaacggcgggggcatgccgtctcatgacgtgcccgta
cgctgggaagtggcgctcgacaaggagttccgccgcatagtcaagcatggcgtggagttc
gcgcggacggcacttgcgcattcggtgcacgtggaagtggaagggctggagccgaatcag
gtgtactactaccggttccatgcaggccatgtggagagtccggtgggcaggaccaagacg
cttccgccttacggcagcgcggtagcgggaatgacctttgcttttgcctcctgtcagaac
tggcaggacggatattacaccgcttacaagcatatgagcaaagagaacctcgatcttgtg
ttccacctcggcgattatatctacgaaggcggcgtcggtacggacaaggtgcggtaccac
aacagtccggagattgtgacgctggaggattaccggaaccggtacgccctgtacaagtcg
gatgcggacctgcgggccgctcacgaggcgttcccttgggtcgtcactacggatgatcat
gaagtggaaaataactacgcggggccgatcccggagaaggaccagccggtcgagccgttc
gtacagcgccgggcggcggcctaccaggcttattacgagcacatgccgcttcgccgctcc
tcgctgccgtacgggaccgagatgcagctgtaccgccgggtgacttacggcaatctggcg
gaattcagcgtgctggatacccgccaataccgcgacgaccaggcgaacggcgacggctcg
aaggagccgaacgaggcgtcgatggatccgaaccggaccctgatgggtgccgcgcaggag
cgctggctgctggaggggctcggtgcctccgccgcacgctggaacgtgattccgcagcag
gtgtttttcgccaaacgggacttcaagcagggggatgcggagcttgtcagcatggatgcc
tgggacggctactcggcgaaccgggaccggatcgtgaacttcatcaaggaacgcggggtc
cgcaacgtggtggtgcttaccggcgacgtccacgcgaattatgccaatgagatcaaggcg
gattaccatgatccggcgtccccggtgatcggggtggagttcgtgggcacttcgatctct
tcggggggcgacggtgcggatacggcggccaatacggcgacaatcctggcggagaatccg
catatccgcttccacaacacccagcgcggctatgtccgctgcacgctgacgccggaccgg
ttccaggcggattatctcgtgcttccttatgtgagccggccggatgcgccgatcgagacc
cgcgtttccttcgaggtggaggacggcagaccgggcctgaagaaaatctacgacagcgcg
ctggtggtaacaggctga

DBGET integrated database retrieval system