KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00944Help
Entry
KNP414_00944      CDS       T01550                                 

Gene name
gtaB
Definition
protein GtaB
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KNP414_00944 (gtaB)
   00052 Galactose metabolism
    KNP414_00944 (gtaB)
   00500 Starch and sucrose metabolism
    KNP414_00944 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_00944 (gtaB)
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KNP414_00944 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985276..986157
Genome map
AA seq 293 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGK
RAIEDHFDNYFELEANLQEKGKLDLLAEVRYPTSMADIHYIRQKEPKGLGHAIWCARKFI
GDEPFAVLLGDDIVVSEKPCLQQMIEIYDTYQVSVLGVQNVEPETVSRYGIVDGMQLEDR
VTRVTRLVEKPKREEAPSTQAILGRYILTPRIFDVLENQATGAGGEIQLTDAIAALNRME
AVYAYEFEGTRYDVGEKLGFIQTMLDFSLQRPDLRDDVLAYMQKIVEQAAQLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcaagaaggccatcattcccgcagcaggacttggaacccggttcctgcctgca
accaaagccatgccgaaggaaatgcttccgatcgtggacaagcccacgatccaatacatt
gtagaggaagccgttgcctcgggtattgaggatatcattatcgtaacaggaaaaggcaag
cgggcgatcgaggatcatttcgataactattttgaactcgaagccaatctgcaggagaag
ggcaagctggatctgcttgccgaagtccgttatccgacctccatggcggatatccattat
atccggcagaaggagcccaaaggactgggacatgccatctggtgcgcacggaagtttatc
ggcgacgagccgtttgcggtcctgctgggagatgacattgtcgtctccgagaagccctgc
ctgcagcagatgatcgaaatctacgatacttaccaggtatccgtactgggtgttcagaat
gtggagcctgagacggtatcccggtatgggatcgtagacggcatgcagcttgaggaccgc
gttacccgtgtaacccggctcgtcgagaagccgaagcgcgaggaggccccgtccactcag
gcgatcctcggacgctatattttaacgccgcggattttcgatgtgctcgagaatcaggct
acgggtgcaggcggagaaattcagctcacggatgcgatcgcagcgctgaaccggatggaa
gccgtctatgcttacgagtttgaaggcacgcggtatgacgtgggcgagaagctaggcttt
atccagacgatgctggatttctccctgcagcggccggatctgcgcgatgatgttctggct
tatatgcagaagatcgtggaacaagccgcccaattgaagtaa

DBGET integrated database retrieval system