KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00951Help
Entry
KNP414_00951      CDS       T01550                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KNP414_00951
Enzymes [BR:pms01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KNP414_00951
Peptidases [BR:pms01002]
 Cysteine Peptidases
  Family C44
   KNP414_00951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993527..995401
Genome map
AA seq 624 aa AA seqDB search
MCGIAGFCTSDANQARPEILQAMIEEIHHRGPDNHGIRFYPGDRQEVIGLGHKRLSIIDL
SDNGKQPMASVSGNTSIVFNGEIYNYHTIRRELEAEGWTFRTGTDTEVILNLYEKYGEGC
LRHLNGMFAFAIYDHRKKQLFIARDRFGVRPLYYSLQGGTGLAFASELKALWKFPGVKKE
VRFGALYQYARKRYVDHPDTIFEGIEKLKPGHYLIYKEGKAELKEYWDIDNFEELPLSFD
DAVEELDALLLDSIRLRMISDVPVGAFLSGGLDSSLIVAMMAKYSALPIKTYSVGFEDER
YSELGFARQVAERFGTDHTELKVSASDFAQHLYQAVTYRDAPLSESADIPMYMLSRMAKK
DVSVILTGEGSDELFAGYPKYAYDRFAKAPWFRGLLKNPLAAAAINALPYSARKAKLAYH
TLCIDDDRQRYGRWFSSIGEEAARTLFTREFQEQYLGSREERQPSVLKGTSNMNRMQYQD
VKYWLSDNLLERGDRMVMAASVEGRLPFLDYRVGEFAFRLPEHYRIRGMERKYIVKKLAE
RYLPKELIYRKKIGFYVPVGDWFRNELKDFVGEHLLSDTFRSRGIFEAGKVEEMFSAHSR
GTVNYEKELWTLLNLEIWFRACID
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtatcgcaggcttttgtacctctgatgcgaatcaggcccgtcctgaaattttg
caggcgatgatcgaggaaatccatcatcgggggccggacaatcatgggatccgcttctat
ccaggtgaccggcaggaggtgatcggcctcgggcataagaggctgagcatcattgatctc
agcgacaatggtaaacagcccatggcttcggtcagcgggaatacgtcgattgtttttaac
ggagagatctataattaccacaccataaggcgcgagctggaagcggaaggctggaccttt
cggacgggaaccgatacggaagtcatcctgaacttgtatgaaaagtatggtgaaggctgc
ctccggcatctcaacggcatgttcgcctttgcaatatacgatcaccggaagaaacagctg
ttcatcgccagagaccgttttggggtaagacccctgtattattcgctgcagggggggacg
gggctggcgttcgcatccgaactcaaggctctgtggaaattcccgggcgtgaagaaagaa
gtgcggttcggggcgctctaccaatatgcccggaagcgctacgtggatcatccggacacg
atcttcgagggcattgagaagctgaagccgggccactacctgatctataaggaaggcaag
gcggagctcaaggagtactgggatatcgacaatttcgaagagcttcccctgtcgttcgat
gatgccgtagaggagcttgatgcgctcctgctggattcgatccggcttcggatgatcagc
gacgtaccggtaggagccttcctgagcggcggtctcgattcgagcctgattgtggccatg
atggcgaagtacagcgcgctgccgatcaagacttactccgtcgggttcgaagacgaaagg
tacagcgaactgggctttgcccggcaagtggcggagcgcttcggaaccgatcatacggag
ctcaaggtgagcgcgtccgacttcgcacagcacctgtatcaggcggtaacttacagggat
gcgccgctttccgagtcggcggatataccgatgtatatgctgtcccggatggccaagaag
gatgtcagcgtcatcctgaccggggaagggagcgacgagctgttcgccggttatccgaag
tatgcctatgaccggttcgccaaggctccgtggttccgcggtctgctcaagaatccgctc
gcagccgcggcgatcaacgcgcttccctattctgcacgcaaagccaagctcgcttaccat
accttatgcattgacgatgaccggcagcgttacggccgctggttctcctccatcggggaa
gaggcggcacgcacgctgttcacccgggagttccaggaacagtacctcggaagcagggaa
gagcggcagccttccgtgctcaagggaacatccaacatgaaccggatgcagtatcaggat
gtgaagtactggctttcggacaacctgctcgagagaggcgaccggatggtgatggccgcc
tcggtggaaggacgtcttcctttcctcgattaccgtgtgggagagttcgctttccgtctg
ccggagcactaccggattcggggcatggagcgcaagtacatcgtcaagaagcttgcggag
cggtatttgccgaaggagctcatttaccgcaagaagattggcttctacgtaccggtaggg
gattggttccgaaacgagctcaaggacttcgtaggcgagcatctcctgtcggataccttc
cgcagcagagggatcttcgaggccgggaaagtggaggagatgttctccgcccacagccgc
ggtacggtcaactatgagaaagagctgtggacgctgctgaatttggaaatatggtttcgg
gcttgtatagactag

DBGET integrated database retrieval system