KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01001Help
Entry
KNP414_01001      CDS       T01550                                 

Definition
chitinase
Orthology
K01183  
chitinase [EC:3.2.1.14]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_01001
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     KNP414_01001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1034325..1036364
Genome map
AA seq 679 aa AA seqDB search
MKRSKPWTIVLTTALLASLVPAAAFGAAAWAPNVAYKVGDLADYSGSTYQVLQNHTSQTG
WEPSNVPALWKLVSSGGTADTQAPSAPANLISAAKTSTSVTLSWGASADNVGVAGYDVYR
GTTLAGTATGTSFTVSGLTANTAYTFTVKAKDAAGNVSPSSNVLSVTTSPASAADTQAPT
VPAGLKASGVTSSSVSLSWTASTDNVGVTGYEVYRGTVLAGTAAGTTFTVSGLAASTAYS
FTVKAKDAAGNVSAASTAVSATTSAPPTGGSGGYKIVTYYPAWAVYARNFKVPDIDASKI
THINYAFADICWNGRHGNPDSSSPNPQTWACADETGNINVPNGTIVQGDPWADTGMSYPG
DTWDEPIKGSFKQLIKLKQANPHLKTIISVGGWSWSNRFSDVAADPAARAVFAKSAVDFL
RKYQFDGVDLDWEYPVSGGLAGNSYRPEDKQNYTLLLQTIRAELDKAGTADGRKYLLTIA
SGAGPAFVANTELGKISQTLDWINIMTYDFHGGWDPKAGQNAPLYFDPADPSTDPVNFNV
DKAVANHLNAGVAPSKLVMGLPYYGRGMQGCANVNGGLYQTCSGTAAKGTWENGSFDFYD
LEANYINKNGYTRYWNSVTKTPYLYNPSGGIFISYDDAQSITEKVNYIKSKGLGGAMSWE
VTQDRNRALQTAVKNGLNP
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaagcaaaccatggacgatcgtgctcacgactgccttactggcatcgcttgtc
cccgctgcagccttcggcgccgccgcgtgggctccgaacgtagcttacaaggtcggcgac
ctcgccgattactccggttctacctaccaggtgctgcagaaccatacctcccagacaggc
tgggagccgtcgaacgtaccggccctctggaagctcgtatcgagcggcggaacggccgat
acccaggcgccgagcgcaccggcgaacctgatctcggccgccaagacgtccacctccgta
accctgtcctggggagcttccgccgataacgtgggcgtggccggctatgacgtctaccgt
ggaacgaccctggccggcacggccacgggaaccagcttcacggtgagcggcctgacggcg
aacaccgcctataccttcacggtgaaggcgaaggatgcagcagggaacgtatcgccttcg
agcaatgtgctgtcggtgacgacaagcccggcatccgctgcggatacgcaggcgccgacc
gtgccggcagggctcaaggcttcgggcgtgacgagcagctccgtttcgctgtcctggacg
gcttcgacggacaacgtgggcgtgaccggttatgaggtgtatcgcggcaccgtactggca
ggtacagcggcgggcaccacgtttaccgtcagcggtcttgcggccagcacggcgtattcc
tttaccgtgaaggcgaaggatgcggcgggcaacgtatcggcggcgagcacggccgtatcc
gccacgacctccgcaccgcctacaggcggcagcggcggctacaagatcgtgacctattat
ccggcctgggccgtgtatgcccggaacttcaaggtgccggatatcgatgcgagcaagatc
acgcacatcaattatgcattcgctgacatctgctggaacggcaggcacggcaatccagat
tcgtccagcccgaacccgcagacgtgggcttgtgccgatgagaccggcaatatcaacgtg
ccgaacgggacgatcgtgcagggcgacccttgggccgacacgggcatgtcctatcccggc
gatacctgggacgagccgatcaagggcagcttcaagcagctcatcaagctgaagcaggcg
aacccgcacctgaagacgatcatctccgtgggaggctggtcgtggtccaaccgcttctcc
gatgtggcggccgatccggcggcgcgcgccgtcttcgccaagtcggcggtggattttctc
cgcaagtaccagtttgacggcgtggatctggactgggagtatccggtgagcggcggtctg
gccggcaattcctaccgtccggaagacaagcagaattacacgcttctgctgcagacgatc
cgtgccgagctggacaaggccggaacggcggacggcaggaagtaccttctgacgatcgct
tcgggtgcaggaccggcgtttgtcgccaacacggagctcggcaagatctcccagacgctc
gactggatcaacatcatgacctatgatttccacgggggctgggatccgaaagcgggacag
aatgcgccgctctacttcgatccggccgatccgagcaccgatcccgtgaacttcaacgtg
gacaaagcggtcgcgaatcatctgaacgcgggcgtggcaccgtccaagctggtcatgggc
ctgccttattacggacgcgggatgcagggctgcgcgaacgtgaacggcggcttgtaccag
acgtgctccggtacggcggccaaaggcacatgggagaacggctcgttcgacttctatgac
ctggaggccaattacatcaacaagaacggctacacccgctactggaacagcgtgacgaag
acgccttacctctataatccatccggcggcatcttcatttcttatgacgatgcgcagtcg
atcacggagaaggtcaactacatcaagagcaaagggcttggcggcgccatgtcctgggaa
gtgacgcaggaccgcaaccgagcgcttcagacggcagtcaaaaacggacttaatccataa

DBGET integrated database retrieval system