KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01283Help
Entry
KNP414_01283      CDS       T01550                                 

Gene name
mdh
Definition
hypothetical protein
Orthology
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Class
Metabolism; Overview; Carbon metabolism [PATH:pms01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pms00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pms00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pms00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:pms00680]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pms00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290724..1291665
Genome map
AA seq 313 aa AA seqDB search
MAIQRKKITVVGAGFTGATTALMLAQKELGDVVLLDIPQLENPTKGKALDMLEASPVQGF
DAKIIGTSSYDDSASSDIVIITAGIARKPGMSRDDLVNTNAGIVKSVCENIKRTSPQSIV
IILSNPVDAMTYVAFETLGFPKNRVIGQSGVLDTARYCTFIAQELNVSVEDVRGFVLGGH
GDDMVPLVRYSNVGGIPIEKLIPADRIDAIVKRTRTGGGEIVNLLGNGSAYYAPAASLVQ
MTEAILKDKKRIIPAIALLQGEYGYDNLFMGVPTLLGGDGIEKVFELELLPEEKAALDKS
AESVRNVTKVVTG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctatccaacggaagaagattacggttgtgggcgccggtttcaccggcgcaacgaca
gctctgatgcttgcacaaaaagaactcggtgacgtagtgctgctcgacattccgcagctc
gagaatccgaccaaagggaaggcgctcgacatgctcgaggcttccccggtgcagggattc
gacgccaagatcatcggtacgtcttcgtatgacgattccgcgagctccgacatcgtgatc
atcacggcgggaatcgcacggaaaccgggcatgagccgcgacgatctcgtgaatacgaat
gccggcatcgtgaagtccgtatgtgagaacatcaagagaacgtctccacagtcgatcgtc
atcattctctccaacccggtggatgcgatgacgtacgtcgcattcgagacgctgggcttc
ccgaagaaccgcgtcatcggccagtccggtgtgcttgacaccgcacgctactgcaccttc
atcgcgcaagaactgaatgtgtccgtagaagacgttcgcggcttcgttctcggcggccac
ggtgacgacatggtaccgcttgtccgttactccaacgtcggcgggattccgatcgagaag
ctgatcccggcggaccgcatcgacgcgatcgtgaagcgtacgcgcaccggcggaggcgag
atcgtcaacctgctcggcaacggttccgcctactacgctcccgcggcatcgctcgttcaa
atgacggaagcgatcctgaaggacaagaagcggatcattcctgcgatcgctctgctccaa
ggcgagtacggctacgacaacctgttcatgggcgttcctacgctgctcggcggcgacggc
atcgagaaagtattcgagctcgagctgctgccggaagagaaggccgccctggataagtcg
gctgaatccgttcgcaatgtcaccaaagtggtaacgggctga

DBGET integrated database retrieval system