KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01301Help
Entry
KNP414_01301      CDS       T01550                                 

Gene name
mutM
Definition
protein Mutprotein M
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pms03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312661..1313503
Genome map
AA seq 280 aa AA seqDB search
MPELPEVETVRRTLNVLVAGKTIERVSVHLKRIIQHPDDIETFKALLEGETIQEVERRGK
FLRIHTDRFTVVSHLRMEGRYGVYKADDPLELHTHVVFHFTDGTELRYKDVRQFGTMHIY
ERGRDLEEKPLKKLGLEPLDEAFTFEAFRSRIAGRKTKIKPLLLNQEYIVGIGNIYVDES
LFLAGIHPEREADTLTKAEMIRLHQAIIQTLTDAVEAGGSSIKSFVNGQGEMGMFQHSFR
VYGRKNEPCPNCGHAIEKTVVGGRGTHTCPKCQKMKRKRS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccggaggtagaaacggtccgcaggacgctgaacgtcctcgtggccggc
aagacgatcgagcgggtgtcggtgcacctgaagcggattatccagcacccggatgacatc
gagacgttcaaggcccttcttgagggcgagacgattcaggaggtggagcgcaggggcaaa
ttcctgcgcatccatacggaccgcttcacggtcgtctcccatctgcggatggaaggacgc
tacggggtttataaagcggatgaccctttggagctgcatacgcatgtcgtgtttcatttt
acggacggcacggagctccggtataaggatgtgcgccagttcggcacgatgcatatctac
gaacgggggcgggacctggaggagaagccgctgaagaagctggggctcgagcctctggac
gaagcgttcaccttcgaagcgttccgcagccggatcgccggccggaagacgaagatcaag
ccgctgctgctcaatcaggaatatatcgtcggaatcgggaatatttatgtggatgaatcc
ctcttcctggcaggcattcaccctgagcgggaagcggacacgctgacgaaagcggagatg
attcggctccaccaggccatcatccagacgcttaccgatgcggtggaggccggcgggtcg
tccatcaagtcgttcgtcaacggccagggggagatgggtatgttccagcacagcttccgc
gtgtacggccgcaagaacgaaccgtgcccgaactgcggacacgccatcgagaagacggtg
gtcggaggccgcggcacgcatacgtgtccgaagtgccagaagatgaaacgcaagcgcagt
tag

DBGET integrated database retrieval system