KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01469Help
Entry
KNP414_01469      CDS       T01550                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00500  Starch and sucrose metabolism
pms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KNP414_01469
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KNP414_01469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_X2 ICAP-1_inte_bdg
Motif
Other DBs
NCBI-ProteinID: AEI40033
UniProt: F8FMF0
Position
1489377..1490999
Genome map
AA seq 540 aa AA seqDB search
MLRKPFVPLAALMSALLLLTSAGAAGYAEEAAPGTSQVNAFRAVTAVQAAKAMSPGWNLG
NTLDAYPDEGSWNNPPAEETIFEDIRAAGFRSVRIPVTWDSKIGPAPDYIIDPARLDRVE
EVVDWALERGLYTVLNVHHDNGNWVTKMAVDPVTGLYVDDYNRNMDKLEKVWKQIAGRFK
DKSEKLLFEVLNEPNNGEWEPKIEAPTDPEYPEARHHLTPEELNAMNHRMLKAIRTSGGS
NASRIVVIGAEMDNSEKAVAHLEVPDDPYLMATFHYYTPYPFISNSWGHTAWGTPEDKAE
LTRYFKPVYDTFVRKGIPVLLGEFGTFVDPEAYAKSYYFNAVVRASYKYGFVPMYWDNGL
DNYDRKARVWRDETAKDVIVRAALGEINSFIGMRDAYFPQGKEPGDLVLPLELGGNELTG
IYHGYYRLVQDRDYVMNEEQTEMTLYGGFIAKLLPARGEAGAKETLRFRFSEGADQPLNL
IRFAQPVLQDTKLTIPAGALKENLKIPVQYNGTKLATARMVDAATGRPVKDEWAQGYVNR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaaaccctttgtcccccttgccgccctgatgtccgcactgcttctgcttacc
tctgccggggcggcggggtatgcggaggaggcggcccccggcacttcacaggtgaacgcc
ttccgggccgtcaccgcggttcaggcggccaaggcgatgtcgcccggttggaatctcggc
aacacgctggatgcttacccggatgagggctcctggaacaaccctccggcggaggaaacg
atatttgaagatatccgggcggcgggcttccgcagtgtccggattcccgtgacctgggac
agcaagatcggacccgccccggattatatcatcgatcccgcccggctcgaccgggtggag
gaggttgtggactgggcactcgagcgggggctctacacggtcctgaacgtgcaccacgac
aacggcaactgggtgacgaagatggcggtcgatccggtcaccggcctgtacgtcgacgat
tacaaccgcaatatggacaagctggagaaggtctggaagcagatcgccgggcggttcaag
gacaagagcgagaagctgctgttcgaggtcctgaacgagcccaacaacggggaatgggaa
ccgaagattgaggcgccgacggaccctgaatatccggaagcgaggcatcacctgacgccg
gaggagcttaacgcgatgaaccaccgcatgctgaaggcgatccggacctcgggcggcagc
aatgcgagccggattgtcgtcattggggcggaaatggacaacagcgagaaagcggtggcc
catcttgaagtgccggacgacccgtatctcatggcgacatttcattactataccccatat
ccgttcatcagcaactcgtggggacatacagcctggggaacgcctgaagacaaggcggag
ctgacccggtacttcaagccggtatatgataccttcgttcgcaaaggcatccccgtgctg
ctgggtgaattcgggacattcgtggatccggaagcttacgcgaagagctattattttaac
gcggtggtccgcgcttcctacaagtacggcttcgtccccatgtattgggacaacggcctg
gataattacgaccgcaaagcgcgggtgtggcgcgacgaaacggctaaagatgtgatcgtc
cgtgcagcccttggcgagatcaactcgttcatcgggatgagggacgcttatttcccgcag
gggaaggaacccggagatctcgtgctgcctctggagctcgggggcaatgagctgaccggt
atttatcacggctattaccggctggtccaagaccgggactacgtcatgaatgaagagcag
accgaaatgacgctctacggcggattcattgcgaagctgcttccggcccgaggggaagcg
ggagccaaggaaacgctgcgcttccggttctccgaaggcgcggaccagccgctgaacctg
atccgctttgcccagccggtgctgcaggacacgaagcttacgatcccggccggcgccctt
aaggagaacctgaagatcccggtgcagtacaacggaacgaagctggcgaccgcccggatg
gtcgatgcggccaccggcaggccggtcaaggacgagtgggcccagggctatgtcaaccgc
tga

DBGET integrated database retrieval system