KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01469Help
Entry
KNP414_01469      CDS       T01550                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pms00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489377..1490999
Genome map
AA seq 540 aa AA seqDB search
MLRKPFVPLAALMSALLLLTSAGAAGYAEEAAPGTSQVNAFRAVTAVQAAKAMSPGWNLG
NTLDAYPDEGSWNNPPAEETIFEDIRAAGFRSVRIPVTWDSKIGPAPDYIIDPARLDRVE
EVVDWALERGLYTVLNVHHDNGNWVTKMAVDPVTGLYVDDYNRNMDKLEKVWKQIAGRFK
DKSEKLLFEVLNEPNNGEWEPKIEAPTDPEYPEARHHLTPEELNAMNHRMLKAIRTSGGS
NASRIVVIGAEMDNSEKAVAHLEVPDDPYLMATFHYYTPYPFISNSWGHTAWGTPEDKAE
LTRYFKPVYDTFVRKGIPVLLGEFGTFVDPEAYAKSYYFNAVVRASYKYGFVPMYWDNGL
DNYDRKARVWRDETAKDVIVRAALGEINSFIGMRDAYFPQGKEPGDLVLPLELGGNELTG
IYHGYYRLVQDRDYVMNEEQTEMTLYGGFIAKLLPARGEAGAKETLRFRFSEGADQPLNL
IRFAQPVLQDTKLTIPAGALKENLKIPVQYNGTKLATARMVDAATGRPVKDEWAQGYVNR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaaaccctttgtcccccttgccgccctgatgtccgcactgcttctgcttacc
tctgccggggcggcggggtatgcggaggaggcggcccccggcacttcacaggtgaacgcc
ttccgggccgtcaccgcggttcaggcggccaaggcgatgtcgcccggttggaatctcggc
aacacgctggatgcttacccggatgagggctcctggaacaaccctccggcggaggaaacg
atatttgaagatatccgggcggcgggcttccgcagtgtccggattcccgtgacctgggac
agcaagatcggacccgccccggattatatcatcgatcccgcccggctcgaccgggtggag
gaggttgtggactgggcactcgagcgggggctctacacggtcctgaacgtgcaccacgac
aacggcaactgggtgacgaagatggcggtcgatccggtcaccggcctgtacgtcgacgat
tacaaccgcaatatggacaagctggagaaggtctggaagcagatcgccgggcggttcaag
gacaagagcgagaagctgctgttcgaggtcctgaacgagcccaacaacggggaatgggaa
ccgaagattgaggcgccgacggaccctgaatatccggaagcgaggcatcacctgacgccg
gaggagcttaacgcgatgaaccaccgcatgctgaaggcgatccggacctcgggcggcagc
aatgcgagccggattgtcgtcattggggcggaaatggacaacagcgagaaagcggtggcc
catcttgaagtgccggacgacccgtatctcatggcgacatttcattactataccccatat
ccgttcatcagcaactcgtggggacatacagcctggggaacgcctgaagacaaggcggag
ctgacccggtacttcaagccggtatatgataccttcgttcgcaaaggcatccccgtgctg
ctgggtgaattcgggacattcgtggatccggaagcttacgcgaagagctattattttaac
gcggtggtccgcgcttcctacaagtacggcttcgtccccatgtattgggacaacggcctg
gataattacgaccgcaaagcgcgggtgtggcgcgacgaaacggctaaagatgtgatcgtc
cgtgcagcccttggcgagatcaactcgttcatcgggatgagggacgcttatttcccgcag
gggaaggaacccggagatctcgtgctgcctctggagctcgggggcaatgagctgaccggt
atttatcacggctattaccggctggtccaagaccgggactacgtcatgaatgaagagcag
accgaaatgacgctctacggcggattcattgcgaagctgcttccggcccgaggggaagcg
ggagccaaggaaacgctgcgcttccggttctccgaaggcgcggaccagccgctgaacctg
atccgctttgcccagccggtgctgcaggacacgaagcttacgatcccggccggcgccctt
aaggagaacctgaagatcccggtgcagtacaacggaacgaagctggcgaccgcccggatg
gtcgatgcggccaccggcaggccggtcaaggacgagtgggcccagggctatgtcaaccgc
tga

DBGET integrated database retrieval system