KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01552Help
Entry
KNP414_01552      CDS       T01550                                 

Gene name
melA2
Definition
MelA2 protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KNP414_01552 (melA2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    KNP414_01552 (melA2)
   00600 Sphingolipid metabolism
    KNP414_01552 (melA2)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KNP414_01552 (melA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566197..1567498
Genome map
AA seq 433 aa AA seqDB search
MADKITFLGAGSTVFAKNVLGDVMLTPALQEFELALFDIDLERLKDSENMLNNLKATAGS
GCVVKAYTDRKEALRGARFVVNAIQVGGYDPCTITDFEIPKKYGLRQTIADTLGIGGIFR
NLRTIPVMMEFARDMQEVCPDAWFLNYTNPMAVLTNAMITHGGIKTVGLCHSVQVCMPHL
FDALGMEKDGVQTKIAGINHMAWLLEVTKDGVDLYPEIKRRALEKQKEKHHDMVRFELMH
RFGYYVTESSEHNAEYHPYFIKKNYPELIDRFNIPLDEYPRRCVEQIERWKSMREELVGS
KNLEHQRSHEYASYIFEAMVTNQPFKIGGNVMNTGLITNLPKEACVEVPCLVDASGVTPT
YVGDLPPQLAALNRTNINTQLLTLEAAFTGKKEHIYHAALLDPHTAAELSIDDIVALCDD
LIEAHGSWLPKFQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaattacgtttcttggtgcgggaagcaccgtgttcgcaaagaatgtgctc
ggcgacgtcatgctgacgccggcgctgcaggagttcgagctcgcgctgttcgatattgac
ttggagcggctgaaggattcggagaatatgctgaataacctgaaggcgaccgccggcagc
ggctgtgttgtgaaagcgtatacggaccggaaggaggcgctgcgcggggccaggtttgtc
gtcaacgcgatccaggtcgggggctacgatccctgcacgatcaccgacttcgagattccg
aagaagtacgggctccggcagacgattgccgacacgctcggtatcgggggcattttccgc
aacctgcgtacgattcccgtgatgatggagtttgcccgggatatgcaggaggtgtgcccc
gacgcctggttcctcaattacacgaatccgatggctgtccttacgaacgcgatgatcacg
cacgggggcatcaagacggtcggcctctgccacagcgtgcaggtgtgcatgcctcatctg
ttcgatgctctgggcatggagaaggacggcgtgcagacgaagatcgcgggcatcaaccac
atggcgtggctgctcgaggtgaccaaggacggcgtcgacctctatccggagatcaagcgc
cgggcgctcgagaagcagaaggagaagcaccatgatatggtgcgcttcgagctcatgcac
cgcttcggctactacgtcaccgagtcttccgagcataatgcggaataccacccgtatttc
atcaaaaagaattatccggagctcatcgaccgcttcaacattccgctcgatgaatatccg
cgccgctgtgtggaacagatcgagcggtggaagtcgatgcgcgaggagctcgtgggcagc
aaaaatctcgagcaccagcgttctcatgaatacgcttcctatatcttcgaggcgatggtc
acgaaccagccgttcaagatcggcggcaacgtcatgaacaccggcctgatcaccaacctg
ccgaaagaggcctgcgtcgaggtgccgtgccttgtggatgcaagcggcgtaacgccgacc
tacgtcggggatctgccgccgcagctggccgcgctcaaccgcacgaacatcaacacgcag
ctcctgacgctggaggccgcgttcaccggtaagaaggaacacatctatcatgcggcgctg
ctcgatccgcacacggccgccgagctgtcgatcgacgatatcgtggcgctgtgcgacgat
ctgatcgaagcccacggcagctggctgccgaagtttcagtaa

DBGET integrated database retrieval system