KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01552Help
Entry
KNP414_01552      CDS       T01550                                 

Gene name
melA2
Definition
MelA2 protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pms00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pms00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pms00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566197..1567498
Genome map
AA seq 433 aa AA seqDB search
MADKITFLGAGSTVFAKNVLGDVMLTPALQEFELALFDIDLERLKDSENMLNNLKATAGS
GCVVKAYTDRKEALRGARFVVNAIQVGGYDPCTITDFEIPKKYGLRQTIADTLGIGGIFR
NLRTIPVMMEFARDMQEVCPDAWFLNYTNPMAVLTNAMITHGGIKTVGLCHSVQVCMPHL
FDALGMEKDGVQTKIAGINHMAWLLEVTKDGVDLYPEIKRRALEKQKEKHHDMVRFELMH
RFGYYVTESSEHNAEYHPYFIKKNYPELIDRFNIPLDEYPRRCVEQIERWKSMREELVGS
KNLEHQRSHEYASYIFEAMVTNQPFKIGGNVMNTGLITNLPKEACVEVPCLVDASGVTPT
YVGDLPPQLAALNRTNINTQLLTLEAAFTGKKEHIYHAALLDPHTAAELSIDDIVALCDD
LIEAHGSWLPKFQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaattacgtttcttggtgcgggaagcaccgtgttcgcaaagaatgtgctc
ggcgacgtcatgctgacgccggcgctgcaggagttcgagctcgcgctgttcgatattgac
ttggagcggctgaaggattcggagaatatgctgaataacctgaaggcgaccgccggcagc
ggctgtgttgtgaaagcgtatacggaccggaaggaggcgctgcgcggggccaggtttgtc
gtcaacgcgatccaggtcgggggctacgatccctgcacgatcaccgacttcgagattccg
aagaagtacgggctccggcagacgattgccgacacgctcggtatcgggggcattttccgc
aacctgcgtacgattcccgtgatgatggagtttgcccgggatatgcaggaggtgtgcccc
gacgcctggttcctcaattacacgaatccgatggctgtccttacgaacgcgatgatcacg
cacgggggcatcaagacggtcggcctctgccacagcgtgcaggtgtgcatgcctcatctg
ttcgatgctctgggcatggagaaggacggcgtgcagacgaagatcgcgggcatcaaccac
atggcgtggctgctcgaggtgaccaaggacggcgtcgacctctatccggagatcaagcgc
cgggcgctcgagaagcagaaggagaagcaccatgatatggtgcgcttcgagctcatgcac
cgcttcggctactacgtcaccgagtcttccgagcataatgcggaataccacccgtatttc
atcaaaaagaattatccggagctcatcgaccgcttcaacattccgctcgatgaatatccg
cgccgctgtgtggaacagatcgagcggtggaagtcgatgcgcgaggagctcgtgggcagc
aaaaatctcgagcaccagcgttctcatgaatacgcttcctatatcttcgaggcgatggtc
acgaaccagccgttcaagatcggcggcaacgtcatgaacaccggcctgatcaccaacctg
ccgaaagaggcctgcgtcgaggtgccgtgccttgtggatgcaagcggcgtaacgccgacc
tacgtcggggatctgccgccgcagctggccgcgctcaaccgcacgaacatcaacacgcag
ctcctgacgctggaggccgcgttcaccggtaagaaggaacacatctatcatgcggcgctg
ctcgatccgcacacggccgccgagctgtcgatcgacgatatcgtggcgctgtgcgacgat
ctgatcgaagcccacggcagctggctgccgaagtttcagtaa

DBGET integrated database retrieval system