KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01595Help
Entry
KNP414_01595      CDS       T01550                                 

Gene name
pfkA
Definition
protein PfkA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KNP414_01595 (pfkA)
   01230 Biosynthesis of amino acids
    KNP414_01595 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_01595 (pfkA)
   00030 Pentose phosphate pathway
    KNP414_01595 (pfkA)
   00051 Fructose and mannose metabolism
    KNP414_01595 (pfkA)
   00052 Galactose metabolism
    KNP414_01595 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KNP414_01595 (pfkA)
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KNP414_01595 (pfkA)
Protein phosphatases and associated proteins [BR:pms01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KNP414_01595 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609176..1610141
Genome map
AA seq 321 aa AA seqDB search
MSVKKIAVLTSGGDSQGMNAAVRAVVRSGLFHGLEVFAVQRGYAGLINDDIRPMDLRSVG
DIIQRGGTVLQTARCKEFLTPEGQQLGADNLRKHGIDGLVVIGGDGSYQGANKLSKLGIK
TMGLPGTIDNDIPFTDFTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIAL
YAGLASGAETIIVPEVGYDMDEISNRMAENFAQGKRHSIIIVAEGVCGGDEIAAEITKRN
GIEPRVTVLGHIQRGGAPTHNDRILASSLGDFAVRKLIEGDSGKACGIIKGELTVTDIDK
VVNTKKPFNMELYELAKRLSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaagattgcagtactcaccagcggcggcgattcccaggggatgaacgca
gccgtccgcgccgttgtgcgcagcggcctgttccacggcctcgaagtgttcgccgtccag
cgcggttacgcgggcctgatcaacgatgacatccgtccgatggacctgcgcagcgtcggc
gatattatccagcgcggcggcacggtgctccagacggctcgctgtaaggagttcctgaca
ccggaaggacagcagctcggcgcggacaacctgcgcaagcacggcatcgacggactcgtc
gtgatcggcggggacggctcgtaccagggcgcgaacaagctcagcaagctcggcatcaag
acgatgggcctgccgggcaccatcgacaacgacatcccgttcacggacttcacgatcggc
ttcgatacggcggtctccatcgtggtcgatgcgatcaacaagctgcgtgatacgatgagc
tcgcatgagcgttcgtccatcgtggaagtcatgggccgccactgcggcgacatcgccctg
tatgcgggccttgcgagcggtgcggagacgatcatcgtgccggaagtcggctacgatatg
gacgagatctcgaaccggatggcagagaacttcgcccagggcaagcgccacagtatcatc
atcgtggcggaaggggtctgcggcggcgacgagatcgcggcggagatcaccaagcgcaac
ggcatcgagccgcgcgtaaccgtgctcggccatattcagcgcggcggtgcgccgacgcat
aatgaccggatcctcgcgagcagcctcggcgacttcgccgtgcgcaagctgatcgagggc
gactcgggcaaggcctgcggcatcatcaagggcgagctgaccgtgaccgacatcgacaag
gtcgtcaacacgaagaagccgttcaacatggagctgtacgagctcgcgaagcgtctgtcc
caataa

DBGET integrated database retrieval system