KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01767Help
Entry
KNP414_01767      CDS       T01550                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KNP414_01767
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KNP414_01767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1797096..1798034)
Genome map
AA seq 312 aa AA seqDB search
MEVRTKHDMKPKIAVVGSLNMDIVVSMARMPLVGETVQGSAVHYIPGGKGANQAAGAARL
GAEVKMIGSVGSDIFGTQLVDSLRAFGVDTEAIDMLPGVETGTATILHTREDNCIVVVPG
ANAHCSADAVRHHHALIEQADLLLVQLEVPLDTVREALSIARSAGVRTILNPAPAVPLPA
DILSLADILTPNETELALLSNQPVAETDQALMEQLAYWRELHEGRVVVTRGAIGSSYLEA
GVLQTVKPLKVKVADTTGAGDAFNGALGYCIAAGLPFRTAVDFACRTASLSVTKFGAQGG
LPTWSEVDSTYA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaggacaaagcacgatatgaaacccaagattgcagtcgttggaagtctgaat
atggatatcgtagtatcgatggccaggatgccgttagtcggcgagaccgtgcaaggaagc
gctgttcactacatccccggaggcaagggagccaaccaggccgcaggagccgccaggctt
ggagccgaggtgaagatgatcggatccgtaggatcggacatcttcggcactcagctcgtg
gacagcctccgagcgtttggcgtggacacggaggccattgatatgctgccaggtgtggaa
accggtacagctacgatcctgcatacgagagaggacaactgtatcgtagtcgttcccgga
gcgaatgcccactgctccgcagatgccgtccggcatcaccatgcgctcattgagcaggca
gatctcctgctggttcagctggaagtgcctcttgatacggtacgcgaagcactgagtatt
gcacgcagtgccggtgttcgcaccatcctgaacccggcgcccgctgtgccgcttcctgca
gatatcctttcgcttgcagacattctgacacccaatgagacggaactcgctctgctgtcg
aaccagccggtggctgagacagaccaggcactgatggagcagctggcttactggcgagaa
ctgcatgaaggaagggttgtagtcacacgtggtgcgatcggcagttcctatctggaggct
ggcgtgctccaaaccgtaaagccgcttaaggttaaggtggcggatactaccggggcagga
gatgccttcaacggcgcactgggctattgcatagctgcaggactcccgttcaggaccgcc
gtggacttcgcctgccggaccgcatcgttatccgtgacaaagtttggtgcccagggaggc
cttcccacatggtccgaggtggactccacttatgcgtga

DBGET integrated database retrieval system