KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02111Help
Entry
KNP414_02111      CDS       T01550                                 

Gene name
nag3
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_02111 (nag3)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KNP414_02111 (nag3)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KNP414_02111 (nag3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2227311..2229029
Genome map
AA seq 572 aa AA seqDB search
MKELQTRLQAKPFYLNEEQIRWVEATLSGMTMEEKIGQLFCLIGYTSNEGYLKNLAQNVK
IGGLMCRQMPAAEVIDTVRILQENAQIPLLISANLESGGSGIAKEGTVFGSPLQVAATDD
DGMAYRLGVVCGREGAAVGANWAFSPIVDIDYNFRNPITNTRTFGSDPERVRRMGVQFVK
GLQENGVAASIKHFPGDGLDERDQHLVTTVNDMDCEAWDATYGAVFRDCIEAGAMSVMIG
HIMQPAYSRKLSPGIRDEDILPASLSYEITTKLLKEELGFNGLVITDSTTMAGMVIPMPR
SQSVPRTIAAGCDMFLFTRNFEEDYGYMKQGVADGIITEERLNDAVTKILAMKAALHLPQ
KKAEGTIVPSPERAGEILGAEEHRQWADACADRSVTLVKEEAGVLPISPAKYRKVLLYGI
ETTGGFFEAKESAAGIIKAKLEKEGFTVDLFNPNRGMEGMMVPYSEVKDNYDLILYIVNL
ATKSNQTVVRIEWAFPMGANVPIYMSSVPTVFVSVENPYHLLDVPRVRTYINTYNSAEHT
LDALIDKLTGRSGFHGKSPVDPFCGKWDARLS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctgcagacacggctgcaggcgaagccgttttacttgaacgaggaacagatc
cgctgggtggaggccacgctgtcgggcatgacgatggaggagaagatcgggcagctgttc
tgcctgatcggctatacgagcaatgagggatacctgaagaatctcgcacagaacgtgaag
atcggcggcctgatgtgccggcagatgcctgcagccgaggtgatcgacaccgtgcgcatc
ctgcaggagaacgcgcagatcccgctcttgatctcggcgaacctggagagcgggggcagc
ggcattgccaaggagggcaccgtgttcggctccccgctgcaggtggcggcgacggacgat
gacgggatggcttaccggctcggcgtcgtctgcggacgggaaggggcggccgtcggtgcg
aattgggcgttctccccgatcgtcgacattgactacaacttccgcaatccgattacgaat
acgcgcacgttcggctccgatccggagcgcgtccgccggatgggcgtgcagttcgtgaag
ggactgcaggagaacggcgtggcggcgtccatcaagcacttcccgggcgacgggctcgac
gaacgcgaccagcaccttgtgaccacggtgaacgatatggactgcgaagcgtgggatgcc
acctacggcgccgtcttccgcgactgcatcgaagcgggggcgatgtcggtgatgatcggc
cacatcatgcagccggcctattcccgaaagctcagcccgggtatccgggacgaggatatt
ctgccggcctcgctctcctacgagattaccacgaagctgctgaaggaggagctcggattt
aacggtctcgtgatcacagactccaccacgatggccgggatggtcattccgatgccgcgc
tcccagtccgtaccgcggaccattgccgccggctgcgatatgttcctgttcacgcgcaac
ttcgaggaggactacggttatatgaagcagggcgttgcggacgggatcatcaccgaggag
cgcctgaacgacgccgtgaccaagatcctggcgatgaaggcggcgctgcacctcccgcag
aagaaggcggaaggaacgatcgtgccgagtccggagcgcgccggagaaattctcggagcg
gaggagcaccggcagtgggcagacgcatgcgccgaccggtcggttacgctggtgaaggaa
gaggcgggggttctgccgatctcgccggcgaagtacaggaaggtgctgctctacggcatc
gaaaccacgggaggcttcttcgaagcgaaggagtcagcagccggtatcatcaaggcgaag
ctggagaaggaaggcttcacggtcgatctcttcaacccgaaccggggcatggaagggatg
atggttccttacagcgaggtcaaggacaactatgacctcatcctgtatatcgtgaacctg
gccacgaagagcaaccagaccgtggtccggatcgagtgggctttcccgatgggagccaac
gtgccgatctacatgagctccgtgccgacggtcttcgtctcggtcgagaatccgtaccat
ctgctcgacgtcccgcgtgtccgtacttacatcaatacgtacaactcggcggagcatacg
ctggatgccctgatcgacaagctgaccggccgttccggcttccacggcaagagcccggtg
gacccgttctgcggcaagtgggatgcccggttgtcgtaa

DBGET integrated database retrieval system