KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02540Help
Entry
KNP414_02540      CDS       T01550                                 

Gene name
bglC
Definition
protein BglC
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_02540 (bglC)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KNP414_02540 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2691241..2692683
Genome map
AA seq 480 aa AA seqDB search
MIHTQVRPFPQDFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIEGTTYKGSNGDVAMDH
YHRYREDIALMAEMGLKAYRFSVSWPRIYPSGHGEVNEAGLQFYDNLIDELLAHGIEPVL
TLYHWDVPQALMDEYGAWESRRIIEDFDNYCITLFKRYGDRVKYWVSLNEQNYNTNHGFI
TAMHPPGVKDRKRFYQANHHAFLANAKVIDSFRHYVPHGKIGPSFAYSPAYPASSKPEDL
LAFENAEEFTNYWWLDVYCLGQYPQIPLRYLEEQGLAPVFEEGDLELLRRGRPDFVGVNY
YQTITYETNPLDGVAEGRMNTTGQKGSNQSTGMPGLFKTAANPNLETSNWDWAIDPIGLR
IGMRRITSRYGLPVFITENGLGEFDKLEADDTVHDDYRIAYLRSHLLQCQQAISDGVELI
GYCSWSFTDVLSWLNGYQKRYGFVYIDRDETDARSLRRIKKLSFHWYREVIRTGGEHLLK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattcatactcaggtacgtccgtttccgcaggattttctctggggctccgcttcggca
gcctaccagatcgaaggggcctggaatgaggacgggaagggaccgtcggtgtgggatgtg
tttaccaaaatcgaggggacaacgtataaaggaagcaacggcgacgtcgccatggaccat
taccaccgctaccgggaggatatcgcccttatggcggagatggggctgaaagcttaccgc
ttctcggtcagctggccgcggatctatccgtccggccatggcgaggtgaacgaagcgggc
ctgcagttctacgataacctgatcgacgagctgctcgcgcacggcattgagccggtgctt
acgctgtaccactgggatgtcccccaggcgctgatggacgaatatggggcgtgggagtcc
cggcggattatcgaggattttgacaactactgcattaccttgttcaagcgttacggggac
cgggtgaaatactgggtctcgctcaacgagcagaattacaacacgaatcacggctttatt
accgccatgcatccgccgggagtcaaagaccgcaaacgcttctatcaggccaaccatcat
gccttcctggccaatgccaaggtcatcgactccttccgccactacgtgccgcatggtaaa
attggtccaagcttcgcgtattctccggcctatccggcttcgagcaagcctgaggatctg
ctggccttcgagaatgcggaggaattcaccaactactggtggctggatgtctactgcctc
gggcaatatccccagatcccgctgcggtatctcgaagagcaggggctggctcccgtcttc
gaggagggagacctcgagctgctgcgccggggcagaccggacttcgtcggcgtcaactac
tatcagacgattacgtatgagacgaatccgctggacggcgtggccgaaggccggatgaat
acgaccggccagaagggcagcaaccagtcgaccgggatgccggggctgttcaagacggcg
gcgaatccgaatctcgagacctcgaattgggactgggccatcgacccgatcggcctgcgg
atcggcatgcgccgaatcacgagccgctacggcctcccggtcttcatcacggagaacggc
ctcggcgaattcgataagctggaagcggatgacacggtccatgacgattaccggatcgct
tacctgagaagccatctgcttcaatgccagcaggcgatcagcgacggggtggagctcatc
ggctactgctcctggtcgttcaccgatgtgctgagctggctcaacgggtatcagaagcgc
tatggatttgtctatatcgaccgggatgagaccgatgccaggtcgctgcgccggatcaag
aagctcagcttccactggtaccgggaagtcatccgaacaggcggggagcatttgttgaag
taa

DBGET integrated database retrieval system