KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02580Help
Entry
KNP414_02580      CDS       T01550                                 

Gene name
yxjF
Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pms00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pms00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2734396..2735181
Genome map
AA seq 261 aa AA seqDB search
MSQLLRDRTALITGAASGIGLEIARTFAKEGARVVVTDIRTEGALQAASLLQDEGFEALG
LRCDVTQEGEYAAALQAADETYGSLDILVNNAGLQHVAPLEDFPVDKFEFMIKVMLTGAF
IGIKHAFPLMKRGGYGRIINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEGASHGIT
VNALCPGYVDTPLVRGQLEDLARTRGVPLESVLEEVIYPLVPQRRLLTVEEIADYAVLIA
SDKLRGVTGASLLIDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagctgcttagagaccgcaccgccctcatcacgggggcggccagcggcatcgga
ttggagatcgcaaggacattcgcaaaggaaggggcccgggtggtcgtcactgacatccgg
accgagggggcgctgcaggcggcttccctgctgcaggacgaaggcttcgaagcgctcggc
ctgcggtgcgacgtgacgcaggaaggggagtatgcggcggcgcttcaggcagcggacgag
acgtacggctcgctcgatatcctcgtcaataatgcgggactgcagcatgtggcgccgctt
gaggactttcctgtggacaaattcgagttcatgatcaaggtgatgctgacgggagctttt
atcgggatcaagcatgcatttccgctgatgaagcggggcgggtacgggcgcatcatcaac
atggcgtcgatcaacggggtgatcgggttcgccggcaaggcggcttacaacagtgcgaag
cacggattgatcggcctgacgaaggtggcggcgctcgaaggggcgtcccacgggatcacc
gtgaatgcgctctgtccgggctacgtcgatacgccgctggtccgcgggcagctggaggat
ctggcgcgcacacggggcgtaccgctcgagagcgtgctcgaggaagtgatctacccgctg
gtgccgcagcgcaggctgctgacggtggaggagattgcggactacgctgtgctgatcgcc
agcgacaagctgcggggcgtaacgggagcgtcgctgctgatcgacggtggctatacggcg
cagtaa

DBGET integrated database retrieval system