KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02583Help
Entry
KNP414_02583      CDS       T01550                                 

Gene name
atoB
Definition
(GenBank) AtoB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00071  Fatty acid degradation
pms00072  Synthesis and degradation of ketone bodies
pms00280  Valine, leucine and isoleucine degradation
pms00310  Lysine degradation
pms00362  Benzoate degradation
pms00380  Tryptophan metabolism
pms00620  Pyruvate metabolism
pms00630  Glyoxylate and dicarboxylate metabolism
pms00640  Propanoate metabolism
pms00650  Butanoate metabolism
pms00900  Terpenoid backbone biosynthesis
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
pms01212  Fatty acid metabolism
pms02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KNP414_02583 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    KNP414_02583 (atoB)
   00640 Propanoate metabolism
    KNP414_02583 (atoB)
   00650 Butanoate metabolism
    KNP414_02583 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    KNP414_02583 (atoB)
   00072 Synthesis and degradation of ketone bodies
    KNP414_02583 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KNP414_02583 (atoB)
   00310 Lysine degradation
    KNP414_02583 (atoB)
   00380 Tryptophan metabolism
    KNP414_02583 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KNP414_02583 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KNP414_02583 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KNP414_02583 (atoB)
Enzymes [BR:pms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KNP414_02583 (atoB)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KNP414_02583 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt DUF2802
Motif
Other DBs
NCBI-ProteinID: AEI41144
UniProt: F8FAQ5
Position
2736712..2737428
Genome map
AA seq 238 aa AA seqDB search
MNTDREAVIVSGVRTAIGSFQGSLAGISAPELGSIVVKEALQRAGIGEEHVDEVILGSVL
QAGLGQNPARQAWLKADFGVSVPAMTVNKVCGSGLKAVMLAAQAVLLGDAEVVVAGGMEN
MSRAPYLLPGARDGLRLGDAALVDSLVRDGLWCASCDIHMGLTAENIAERYGLTREEQDA
FAAESQRRAAEAASAGRLQAEIVPVPVPQRKGPPVLFAVDEHRWPASGAMRRRRWTRP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggatagggaagcggttattgtcagcggagtccggacggcgatcgggagcttt
cagggttctctggcgggaatctcggccccggagctcggcagcatcgtagtgaaggaagcg
ctgcagcgggcaggtatcggcgaggagcatgtggatgaggtgatcctcggcagcgtgctg
caggcgggactcggccagaatccggcccggcaggcctggctgaaggcggacttcggcgtc
tcggtgccggcgatgacggtcaacaaggtgtgcggctccgggctcaaagccgtgatgctg
gctgcacaggccgtactcctcggcgatgccgaggtcgtggtggccggggggatggagaac
atgagccgggcgccttacctgctgccgggggcaagggacggcctgcggctcggcgatgcc
gcactcgtcgactcgctcgtccgcgacggcctgtggtgcgcctcctgcgatattcacatg
ggcctcacggccgagaatatcgcggaacggtacgggctgacgcgggaggagcaggacgcc
ttcgcggcggagagccagcggcgggcggcggaggcggcatcggccggccggctgcaagcc
gagatcgtgccggtgcccgtgccgcagcgcaaggggccgccggtgctcttcgccgtggac
gagcaccgctggcccgcatccggggctatgcgcaggcggcgctggacccggccgtga

DBGET integrated database retrieval system