KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02584Help
Entry
KNP414_02584      CDS       T01550                                 

Gene name
atoB2
Definition
(GenBank) AtoB2
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KNP414_02584 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    KNP414_02584 (atoB2)
   00640 Propanoate metabolism
    KNP414_02584 (atoB2)
   00650 Butanoate metabolism
    KNP414_02584 (atoB2)
  Lipid metabolism
   00071 Fatty acid degradation
    KNP414_02584 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    KNP414_02584 (atoB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KNP414_02584 (atoB2)
   00310 Lysine degradation
    KNP414_02584 (atoB2)
   00380 Tryptophan metabolism
    KNP414_02584 (atoB2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KNP414_02584 (atoB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KNP414_02584 (atoB2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KNP414_02584 (atoB2)
Enzymes [BR:pms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KNP414_02584 (atoB2)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KNP414_02584 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2737425..2737760
Genome map
AA seq 111 aa AA seqDB search
MMGLGPVDAVRRLVQKTGVALDSVELFELNEAFAAQSLAVMRELGVPADRVNVNGGAIAL
GHPIGASGARVLVTLLHELARREARYGIAALCIGGGQGVAMLVEWVEQSAG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggactcgggcctgtcgacgccgtgcgccggctcgtgcagaagacgggcgtggcg
ctggactcggtggagctcttcgagctcaacgaggcgttcgccgcccagtccctggccgtc
atgcgcgagctgggcgtgcccgcggaccgcgtgaacgtcaacggcggcgccatcgccctc
ggccacccgatcggggctagcggagcccgcgtgctcgtcacgctgctgcacgagctagcc
cggcgggaggcgcgctatggcatcgccgcgctgtgtatcggcggcggccagggcgttgcg
atgctcgtggagtgggtggagcagagcgcggggtag

DBGET integrated database retrieval system