KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02796Help
Entry
KNP414_02796      CDS       T01550                                 

Gene name
trpB
Definition
(GenBank) TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KNP414_02796 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_02796 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KNP414_02796 (trpB)
Enzymes [BR:pms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KNP414_02796 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2921766..2922965
Genome map
AA seq 399 aa AA seqDB search
MFNGPDEFGRFGKFGGRYVPETLMNALIELEDAFKTISKTDKFQEELTYWLHRYSGRPTS
LYYAGRLTEHLGGAKVYLKREDLNHTGAHKINNALGQGLLAKYMGKTKIIAETGAGQHGV
ATATVAALLGFECKVFMGEEDMKRQQLNVFRMNLLGTEVVPVTSGTRTLKDACNETLRYW
VSHVEDTFYILGSATGPHPYPLMVRDFQRIIGDEARRQILEQEGRLPDTVIAAVGGGSNA
IGMFYPFIGDEAVKLVGVEAAGHGINTEKHAATMTMGSKGVFQGSYSYLLQDEHGQVQEA
HSISAGLDYPGIGPEHSHLMDTGRAQYVPITDHEAMEALKLLCRTEGIIPALESAHAIAE
TIKRAPQMGKDQIIVVSLSGRGDKDVHTIMSHMEGAVAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacggaccggatgagttcgggcgcttcggcaagttcggcgggcgctatgttccc
gaaacgctgatgaacgcactgatcgagctggaggatgcgttcaaaacgatctccaaaact
gacaagtttcaggaggagctgacctactggcttcaccgctattccggtcgtccgacctcc
ctgtattatgcagggcgtctcaccgagcacctgggcggcgccaaggtgtatttgaagcgc
gaggatttgaatcatacgggtgcgcacaaaatcaacaacgcgctcggacagggccttctg
gccaaatatatgggcaagacgaagatcatcgccgagacgggagccggccagcacggtgta
gcgaccgcaacggtggcggcgctgctcggcttcgagtgcaaggtgttcatgggcgaggaa
gacatgaagcgccagcagctgaacgtcttccgcatgaacctgctcggcaccgaggtggtg
ccggtgacctccggtacccggacgctgaaggatgcctgcaacgagacgctccgctactgg
gtatcccacgtagaggatacgttctatattctcggttcggcgacgggaccgcacccttat
ccgctgatggtccgcgacttccagcgcattatcggcgatgaggcgcgccgccagattctc
gagcaggaaggccgtctgccggatacggtgattgccgcagttggcggcggcagcaatgcg
atcgggatgttctatccgttcatcggcgatgaggccgtgaagctggtcggggtggaagcg
gcaggacacggaattaacaccgagaagcatgcggccacaatgacgatgggcagcaagggc
gtgttccagggctcctacagctacctgctgcaggatgagcacggacaggtgcaggaggcc
cactcgatctccgcaggactggattatccgggcatcggaccggagcactcccatttgatg
gataccggccgtgcccagtatgtgccgattacggatcatgaagcgatggaagcgctgaag
ctgctgtgccggacggaaggcatcatcccggctctcgaaagcgctcatgcgatcgccgag
acgatcaaacgcgcgccgcagatgggcaaggaccagatcatcgtcgtcagcctgtcgggc
cgcggggacaaagacgtgcatacgatcatgagccatatggaaggagctgtagcgaaatga

DBGET integrated database retrieval system