KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02797Help
Entry
KNP414_02797      CDS       T01550                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pms01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pms00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pms00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922962..2923795
Genome map
AA seq 277 aa AA seqDB search
MNRIDAKFAALKEQELTAFIPFLTIGDPDVRTSIDIIHELEKAGASMVELGVPYSDPLAD
GPVIQRSSMRALKANRITILDVIGAAKTAREEGSELPFILFTYYNPVLQTGLDRIFPLLM
ESSISGLIIPDLPMEEDEEVRRLAEQHGIHLIPLVAPTSRERVERIASRASGFVYCVSSL
GVTGTRTEFHTGIDEFLSTVKGATSLPIAIGFGISTPEQVARFSGVCDGIVVGSALVRTV
EEALPLLSEPASRREGLLQIHDFVRTLVGNGSGIVRT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgacgccaaattcgctgctctgaaggagcaggagcttaccgcattcatt
ccgttcctcaccattggtgacccggatgtccgcacctcgatcgacatcattcacgagctg
gagaaggccggcgcttccatggtggagctcggcgtgccttattccgatccgctggccgac
gggccggtcatccagcgttcctccatgcgggcgctcaaggcgaaccggatcacgattctc
gatgtgatcggggccgccaagacggcgagggaggaaggcagcgagctgccgttcatttta
tttacctattataatccggtgctgcaaaccggccttgaccgaatcttcccgcttctgatg
gagagcagcatcagcggcctcatcatccctgatctgccgatggaagaggatgaggaagtg
cgccggctggcggagcagcacggcatccacctgattccgctggtggcgccgacctcccgg
gagcgcgtggaacggatcgcttccagagcgagcgggttcgtttactgcgtgtcttcgctt
ggcgtgaccggcacccggaccgagttccatacgggcatcgacgagttcctgagcaccgtc
aagggagcgacttcgctgccgatcgccatcggcttcggcatctcgacgccggagcaggtg
gcccgcttctcgggggtctgcgacggcattgtcgtcggcagcgcccttgtgcggacggtc
gaagaggcgctgcctctgctgtccgagccggcctcccgcagagaaggactcttgcaaatt
catgattttgtgcgtacattagtgggaaacggttccggcatcgtgcggacctga

DBGET integrated database retrieval system