KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02797Help
Entry
KNP414_02797      CDS       T01550                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KNP414_02797
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_02797
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KNP414_02797
Enzymes [BR:pms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KNP414_02797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922962..2923795
Genome map
AA seq 277 aa AA seqDB search
MNRIDAKFAALKEQELTAFIPFLTIGDPDVRTSIDIIHELEKAGASMVELGVPYSDPLAD
GPVIQRSSMRALKANRITILDVIGAAKTAREEGSELPFILFTYYNPVLQTGLDRIFPLLM
ESSISGLIIPDLPMEEDEEVRRLAEQHGIHLIPLVAPTSRERVERIASRASGFVYCVSSL
GVTGTRTEFHTGIDEFLSTVKGATSLPIAIGFGISTPEQVARFSGVCDGIVVGSALVRTV
EEALPLLSEPASRREGLLQIHDFVRTLVGNGSGIVRT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgacgccaaattcgctgctctgaaggagcaggagcttaccgcattcatt
ccgttcctcaccattggtgacccggatgtccgcacctcgatcgacatcattcacgagctg
gagaaggccggcgcttccatggtggagctcggcgtgccttattccgatccgctggccgac
gggccggtcatccagcgttcctccatgcgggcgctcaaggcgaaccggatcacgattctc
gatgtgatcggggccgccaagacggcgagggaggaaggcagcgagctgccgttcatttta
tttacctattataatccggtgctgcaaaccggccttgaccgaatcttcccgcttctgatg
gagagcagcatcagcggcctcatcatccctgatctgccgatggaagaggatgaggaagtg
cgccggctggcggagcagcacggcatccacctgattccgctggtggcgccgacctcccgg
gagcgcgtggaacggatcgcttccagagcgagcgggttcgtttactgcgtgtcttcgctt
ggcgtgaccggcacccggaccgagttccatacgggcatcgacgagttcctgagcaccgtc
aagggagcgacttcgctgccgatcgccatcggcttcggcatctcgacgccggagcaggtg
gcccgcttctcgggggtctgcgacggcattgtcgtcggcagcgcccttgtgcggacggtc
gaagaggcgctgcctctgctgtccgagccggcctcccgcagagaaggactcttgcaaatt
catgattttgtgcgtacattagtgggaaacggttccggcatcgtgcggacctga

DBGET integrated database retrieval system