KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02859Help
Entry
KNP414_02859      CDS       T01550                                 

Gene name
glgB
Definition
protein GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pms00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2987099..2989051
Genome map
AA seq 650 aa AA seqDB search
MSSLIPEPEDLYLFHEGNLFRSYRMLGAHTGTWNGADGVRFTVWAPHAREVRVVGDFNNW
DGSAHAMHRISTWGVWTLFIPEVSEGEYYKYEILTSQGTLIYKADPYGFWAELKPGTASR
IYNLDGFEWSDGAWQEKKRTTPVYNAPMNIYEVHLGTWKKREDGSYYTYRELADELVSYV
AEMGYTHIELMPLAEHPYDRSWGYQATGYYSVTSRFGTPKDFMYFVDCCHAAGIGVIMDW
VPGHFVKDEHGLRQFDGEPLYEYRDEARAEKPEWGTLSFDFTKPEVVSFLISNALFWFDM
YHIDGLRVDAVASLLYLNFGKPRELWVKNEHGGDENTEAIAFLKKLNHTVFSAYPDALMM
AEDSSAWPLVTAPVHAGGLGFNYKWNMGWMNDMLKYMEMDPYFRGGNHQLLTFSFMYTHA
ENYVLPLSHDEVVHGKRSLLNKMPGDYWQKFANLRVLYGYMMSHPGKKLLFMGGEFGQFD
EWKDLEDLDWEMLGYESHNSMHRYVKDLNHLYLAEPSLWELDHSPEGFSWIDPNDQKQSV
TTFMRMSTKPEDTLIIVNNFTPVYHERYRIGVPFSGEYVERFNSDAGEYGGSGKLNAGRL
KTDGISWHYQQDSLHISLPPLSTVMFKPVRIMPPPAKPAAPKRGRGKADA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtctaatccccgaaccggaagacttgtatctgttccatgaagggaacctgttc
cgcagctaccgcatgctgggagcgcacaccggaacatggaacggagcggacggcgtccgc
ttcacggtatgggccccgcacgcccgggaagtccgggtggtgggcgatttcaacaattgg
gacggctcagcccacgccatgcacaggatcagcacctggggcgtgtggacgctgttcatt
ccggaagttagtgaaggggagtattacaagtacgaaattctgacatcgcagggaacactg
atctacaaagcggatccgtacggattctgggcggagctcaagcccggtacggcatcccgg
atttacaacctggacggattcgaatggtccgacggggcctggcaggagaagaagcggacg
actccggtgtacaatgcacccatgaacatctatgaagtgcacctcggcacctggaagaag
cgggaggacggctcgtactatacataccgggaacttgcggacgagctggtctcttatgtg
gcggagatggggtacacccacatcgagctgatgccgctcgccgagcatccgtacgaccgc
tcctggggctaccaggccacgggctattattcggtgacgagccggttcggcacaccgaaa
gattttatgtattttgtggactgctgccacgcggcgggcatcggggtcatcatggactgg
gtgccgggccacttcgtcaaggacgagcacgggctgcggcagttcgacggggaacccttg
tacgagtaccgcgacgaggcccgggcggagaagccggaatggggaacgctttcttttgac
tttacgaagccggaagtcgtgtccttcctcatctccaacgccttgttctggttcgacatg
tatcacattgacggtctgcgggtcgatgccgtcgcctcgctgctctatctcaacttcggc
aagccgcgcgagctgtgggtgaagaacgagcatgggggagacgagaacaccgaagcgatc
gccttcctcaaaaaactgaatcataccgtcttcagcgcctatcccgacgcgctcatgatg
gccgaggattcctccgcctggccgctcgttacggcgccggtgcatgccggagggctcggt
ttcaactacaaatggaatatgggctggatgaatgatatgctgaaatatatggagatggat
ccctacttccggggaggcaaccaccaactcctgaccttctcgttcatgtacacccatgcc
gagaattatgtgcttccgctctcgcacgacgaggtcgtgcacggcaagcgctcgctgctg
aacaagatgccgggggattactggcagaagttcgcgaatctgcgggtgctgtacgggtac
atgatgtcccatccgggcaagaagctgctcttcatgggcggcgaattcggccagttcgat
gagtggaaggatctcgaggatctcgactgggagatgctcggctatgagagccacaactcc
atgcaccgctatgtgaaggatctgaatcacctgtacctggccgagccctccctctgggag
ctcgaccacagtcccgaaggcttttcctggatcgatccgaacgaccagaagcagagcgta
accacgttcatgcggatgtcgacaaagccggaggataccctcatcatcgtcaacaatttt
acgcctgtgtatcacgagcggtaccggatcggcgttcccttctccggggaatacgtcgaa
cgcttcaacagcgatgcgggggaatacgggggaagcggcaagctgaacgccggcaggctc
aagacggacggcatctcctggcattaccagcaggacagtctgcatatttcgctgccgccg
ctctcgaccgtaatgttcaagccggtgagaatcatgccgccgcccgccaaacccgccgca
cccaaacgaggaaggggtaaagccgatgcgtaa

DBGET integrated database retrieval system