KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02860Help
Entry
KNP414_02860      CDS       T01550                                 

Gene name
glgC
Definition
protein GlgC
Orthology
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KNP414_02860 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_02860 (glgC)
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     KNP414_02860 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2989044..2990213
Genome map
AA seq 389 aa AA seqDB search
MRKKECVAMLLAGGEGRRLGVLTSKLAKPAVHFGGKYRIIDFTLSNCTNSGIDTVGVLTQ
YQPLVLNTYIGIGAPWDLDRKHGGVTVLPPYMEQGGGDWYKGTANAIYRNISFIEQYDPE
YVLVISGDHIYKMDYDRMLDYHKQRGADATIAVIGVKWEEASRFGIMATDEEGRITEFAE
KPKEPKSNLASMGIYIFSWKALKEQLIKDEEDEESSKDFGKDLIPRMLRENLNLVAYPFE
GYWKDVGTIQSLWEANMDLLEKEPAFKLNDREWRIYSVNPLQPGQYIAGTAQVRRSLVNE
GCCVFGEVDHSVLFYGVQVGEGSLIKDSVIMPNVTIGSNVKIYKAIIGEGTVVEDGAVIG
TPEEEGGGDIVLIGSNERVGKTATTTGKG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaagaatgcgtggccatgctgcttgcaggtggcgaaggaagacgactcgga
gtgctgacgagcaagctggcgaagcccgccgtccacttcggaggaaagtaccggatcatc
gattttacgctgagcaactgcacgaactccggcatcgacacggtaggcgtgctgacgcag
taccagccgctggtgctcaatacatacatagggatcggggccccgtgggacctcgaccgc
aaacacggcggcgtcaccgtacttcccccttacatggagcagggcggaggcgactggtac
aaggggaccgcgaatgcgatctaccgcaatatttcattcatcgagcagtacgacccggaa
tacgtgctcgtcatctccggcgaccatatctacaagatggattacgaccggatgctcgat
tatcataagcaaagaggcgcggacgccacaatcgccgtcatcggcgtcaagtgggaggaa
gcgagccgcttcggcatcatggcgaccgatgaggaaggacgcatcacggaattcgccgag
aagccgaaggagccgaagagcaacctggcctcgatgggcatctatattttctcctggaag
gcactgaaggagcagctcatcaaggacgaggaggacgaggaatccagcaaggacttcggc
aaggatctcatcccgcgcatgctccgcgagaacctcaatctcgtcgcctatccgttcgag
ggctactggaaggatgtcggtacgatccagagtctctgggaagccaacatggacctgctg
gagaaagagccggcgttcaagctcaatgaccgcgaatggcgcatctactccgtcaacccg
ctgcagccgggccagtatattgccggtaccgcccaggtccgccggtccctcgtcaatgaa
ggctgctgcgtcttcggcgaggtcgaccattcggtgctcttctacggcgtccaggtaggc
gaaggcagtctgatcaaggattcggtcatcatgccgaacgtgacgatcggcagcaacgtg
aagatctacaaagcgattatcggcgaaggcacggtggtcgaagacggcgccgtcatcggc
acgccggaggaagaaggcggcggggacatcgtcctcatcggcagcaacgagcgggtcggc
aagaccgccaccacaaccgggaaagggtga

DBGET integrated database retrieval system